(data stored in ACNUC1104 zone)

EMBL: CP000959.PE346

CP000959.PE346       Location/Qualifiers
FT   CDS             408106..409455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3535"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bxe:Bxe_B2605 major
FT                   facilitator superfamily (MFS)metabolite/H+ symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3535"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92687"
FT                   /db_xref="GOA:B1K333"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B1K333"
FT                   /protein_id="ACA92687.1"
FT                   /translation="MQSILQADVPASAATTLSRSQTRRAVLASVIGNGLEWFDFLIYGY
FT                   FAKIIAQVFFPVGNGFASITLTLATFAVGFVVRPLGGIVIGACADRYGRRKTLSLLILL
FT                   MAASTLMMGLTPSYAAIGMAAPLVVILARILQGLSVGGEFATAAAMLTEYAPPGRKMFF
FT                   GSFQMTSQAVALLLSSLCSFLLTTHLSHQSLVTWGWRVPFLLGALVGPVGFYIRHKVGE
FT                   SPEFVQLRERLGHAPRQSLRTFIRERGDAALCAMGVIIVGAATNYLWHSYMPLYVEHQL
FT                   HLPLKNALFGTAISGLIGIVGYPLAGMLADRLGAYRLFFPVTIVWVCAAYPLFAWVLAA
FT                   PSPERVFSAQIIATVVLSVMSGAHPGMLTQLFPTAMRSTGVALSYNVAVTLFGGLAPLT
FT                   VSTLIDVTGSRIVPAWYLVFAGIVSLLLVGFTASGRRLRREPDLWPGDTA"
     MQSILQADVP ASAATTLSRS QTRRAVLASV IGNGLEWFDF LIYGYFAKII AQVFFPVGNG        60
     FASITLTLAT FAVGFVVRPL GGIVIGACAD RYGRRKTLSL LILLMAASTL MMGLTPSYAA       120
     IGMAAPLVVI LARILQGLSV GGEFATAAAM LTEYAPPGRK MFFGSFQMTS QAVALLLSSL       180
     CSFLLTTHLS HQSLVTWGWR VPFLLGALVG PVGFYIRHKV GESPEFVQLR ERLGHAPRQS       240
     LRTFIRERGD AALCAMGVII VGAATNYLWH SYMPLYVEHQ LHLPLKNALF GTAISGLIGI       300
     VGYPLAGMLA DRLGAYRLFF PVTIVWVCAA YPLFAWVLAA PSPERVFSAQ IIATVVLSVM       360
     SGAHPGMLTQ LFPTAMRSTG VALSYNVAVT LFGGLAPLTV STLIDVTGSR IVPAWYLVFA       420
     GIVSLLLVGF TASGRRLRRE PDLWPGDTA                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page