(data stored in ACNUC1104 zone)

EMBL: CP000959.PE347

CP000959.PE347       Location/Qualifiers
FT   CDS             409464..410492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3536"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2604 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3536"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92688"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1K334"
FT                   /protein_id="ACA92688.1"
FT                   /translation="MCLPRNHEVRPRNEVPVKVVASERLTVSTSRGEAKVPLFTGGSTA
FT                   PATATQVVVMLHGRLRDADAYLRSTQRALDASTADAANVMLAVPQFLATADVAYHPLAD
FT                   DCLHWEWTSWMGGLDAISPAPLSSFDVLDALIEHYVRGMQSGRYPRLREIVIAGHSGGA
FT                   QVAHRHAILSNAPACCLARGVTVRYVIANPSSYVYFDAWRPHGEGIDQTACAGFNEWKY
FT                   GTSRLPRYADGLDAQSLERRYVDHDVTYLLGTHDDDPAHPALDRSCEAMMQGPHRLARG
FT                   RAYFAYLRARHPELRHELHEVQRAGHSGDAMFVSQAGVCALFGPSVRLAESRAEQEGGA
FT                   LE"
     MCLPRNHEVR PRNEVPVKVV ASERLTVSTS RGEAKVPLFT GGSTAPATAT QVVVMLHGRL        60
     RDADAYLRST QRALDASTAD AANVMLAVPQ FLATADVAYH PLADDCLHWE WTSWMGGLDA       120
     ISPAPLSSFD VLDALIEHYV RGMQSGRYPR LREIVIAGHS GGAQVAHRHA ILSNAPACCL       180
     ARGVTVRYVI ANPSSYVYFD AWRPHGEGID QTACAGFNEW KYGTSRLPRY ADGLDAQSLE       240
     RRYVDHDVTY LLGTHDDDPA HPALDRSCEA MMQGPHRLAR GRAYFAYLRA RHPELRHELH       300
     EVQRAGHSGD AMFVSQAGVC ALFGPSVRLA ESRAEQEGGA LE                          342
//

If you have problems or comments...

PBIL Back to PBIL home page