(data stored in ACNUC1104 zone)

EMBL: CP000959.PE349

CP000959.PE349       Location/Qualifiers
FT   CDS             412487..413542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3538"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; KEGG: rle:RL0304 putative CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3538"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92690"
FT                   /db_xref="GOA:B1K336"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1K336"
FT                   /protein_id="ACA92690.1"
FT                   /translation="MNGNINDVSVLVTGGTGFIAQHCILALLNRGYQVRTTVRSLARET
FT                   QVRAQLERGGAEPGGRLSFVEADLLADDGWQQATAGSTYVVHGASPTPTGTQTSEDDWV
FT                   KPAVAGTLRVLRAARDAGVKRVVLTSAFGAICAGHGPMRRPFDETDWSNLAAADVWPYQ
FT                   KSKTLSERAAWDFVAREGRGMQLSAINPVTVLGPVLGDDYSHSIRLIRGMLDGQPGNPR
FT                   INSGFVDVRDVADLHVRAMTHEAANGERFIAIAGESMWLAEVAQVLKARMGDAARHVST
FT                   RVLPDWLVRIGALRDPALRGSLPLLGRNLNATSQKASSLLGWSPRPREDAIVATAESLV
FT                   SLGLLRDAGRR"
     MNGNINDVSV LVTGGTGFIA QHCILALLNR GYQVRTTVRS LARETQVRAQ LERGGAEPGG        60
     RLSFVEADLL ADDGWQQATA GSTYVVHGAS PTPTGTQTSE DDWVKPAVAG TLRVLRAARD       120
     AGVKRVVLTS AFGAICAGHG PMRRPFDETD WSNLAAADVW PYQKSKTLSE RAAWDFVARE       180
     GRGMQLSAIN PVTVLGPVLG DDYSHSIRLI RGMLDGQPGN PRINSGFVDV RDVADLHVRA       240
     MTHEAANGER FIAIAGESMW LAEVAQVLKA RMGDAARHVS TRVLPDWLVR IGALRDPALR       300
     GSLPLLGRNL NATSQKASSL LGWSPRPRED AIVATAESLV SLGLLRDAGR R                351
//

If you have problems or comments...

PBIL Back to PBIL home page