(data stored in ACNUC1104 zone)

EMBL: CP000959.PE35

CP000959.PE35        Location/Qualifiers
FT   CDS             39259..39690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3220"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: bam:Bamb_3715 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3220"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92376"
FT                   /db_xref="GOA:B1K896"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B1K896"
FT                   /protein_id="ACA92376.1"
FT                   /translation="MSELLTYGGLFAVSMVAATLLPLQSEAVLAGLLLAGREPVWALVL
FT                   VASVGNVAGSAINWALGRGIEHFRERRWFPVKPSALARAERWYARYGRWSLLLSWAPVI
FT                   GDPLTMIAGVLREPLPTFLAIVTIAKVGRYLAVAWLVMH"
     MSELLTYGGL FAVSMVAATL LPLQSEAVLA GLLLAGREPV WALVLVASVG NVAGSAINWA        60
     LGRGIEHFRE RRWFPVKPSA LARAERWYAR YGRWSLLLSW APVIGDPLTM IAGVLREPLP       120
     TFLAIVTIAK VGRYLAVAWL VMH                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page