(data stored in ACNUC1104 zone)

EMBL: CP000959.PE350

CP000959.PE350       Location/Qualifiers
FT   CDS             complement(413803..415728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3539"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor"
FT                   /note="TIGRFAM: selenocysteine-specific translation
FT                   elongation factor; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein;
FT                   Elongation factor SelB winged helix 2; Elongation factor
FT                   SelB winged helix 3; KEGG: bur:Bcep18194_B2095 translation
FT                   elongation factor, selenocysteine-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3539"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92691"
FT                   /db_xref="GOA:B1K337"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K337"
FT                   /protein_id="ACA92691.1"
FT                   /translation="MIVGTAGHIDHGKTTLVRALTGVDTDRLKEEKARGISIELGYAYT
FT                   PLGNGDVLGLIDVPGHEKLIHTMAAGACGIDFALLVIAADDGVMPQTREHLAILQLLGV
FT                   THGAVALTKCDRVDAARVAEVRDEIAVWLHDSTLAGVPIFETRATAADDSGVAALKQHL
FT                   ADAAIAWRTRRDDGLFRLAVDRVFTLAGQGTVVTGTAFAGRVATGDTLAIVRTGGAARV
FT                   RSIHAQNRPVEAGRAGERCALNLAGVDKADIERGDTVADARLVATSPRLDVELTLLADA
FT                   GLTLTHWAPLHVHLGTLHRVAHVALLDGDTLAAGQRMRVQLVFDEPVFALPGDRFIVRN
FT                   PQATRTVGGGRVLDPFGPARKRRTPARRAWLDALAAWLDEGRLDALLAQAPLGMARATL
FT                   THLTGFAPDALALPDDALAIGQRDAAANEGAVISHAHWRALQTRAVDTLRAYHERMPDE
FT                   QGLDAARLRRMAAPLVGDTLWRALVDALVTGGEVARSGPWLHLPSHSVSLEPREEALAR
FT                   QLLPLIHAGRFDPPWVRDLARDTGAAEDAVRTLLRKLARRGDVHQVVRDLFYHADIARE
FT                   LAELVAHLAPSRGGGLDAATFRDATGLGRKRAIQILEFFDRVGYTRFHRDLHYLRPDSG
FT                   WAGIQA"
     MIVGTAGHID HGKTTLVRAL TGVDTDRLKE EKARGISIEL GYAYTPLGNG DVLGLIDVPG        60
     HEKLIHTMAA GACGIDFALL VIAADDGVMP QTREHLAILQ LLGVTHGAVA LTKCDRVDAA       120
     RVAEVRDEIA VWLHDSTLAG VPIFETRATA ADDSGVAALK QHLADAAIAW RTRRDDGLFR       180
     LAVDRVFTLA GQGTVVTGTA FAGRVATGDT LAIVRTGGAA RVRSIHAQNR PVEAGRAGER       240
     CALNLAGVDK ADIERGDTVA DARLVATSPR LDVELTLLAD AGLTLTHWAP LHVHLGTLHR       300
     VAHVALLDGD TLAAGQRMRV QLVFDEPVFA LPGDRFIVRN PQATRTVGGG RVLDPFGPAR       360
     KRRTPARRAW LDALAAWLDE GRLDALLAQA PLGMARATLT HLTGFAPDAL ALPDDALAIG       420
     QRDAAANEGA VISHAHWRAL QTRAVDTLRA YHERMPDEQG LDAARLRRMA APLVGDTLWR       480
     ALVDALVTGG EVARSGPWLH LPSHSVSLEP REEALARQLL PLIHAGRFDP PWVRDLARDT       540
     GAAEDAVRTL LRKLARRGDV HQVVRDLFYH ADIARELAEL VAHLAPSRGG GLDAATFRDA       600
     TGLGRKRAIQ ILEFFDRVGY TRFHRDLHYL RPDSGWAGIQ A                           641
//

If you have problems or comments...

PBIL Back to PBIL home page