(data stored in ACNUC1104 zone)

EMBL: CP000959.PE351

CP000959.PE351       Location/Qualifiers
FT   CDS             complement(415725..417164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3540"
FT                   /product="L-seryl-tRNA(Sec) selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; L-seryl-tRNA
FT                   selenium transferase; KEGG: bur:Bcep18194_B2096
FT                   selenocysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3540"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92692"
FT                   /db_xref="GOA:B1K338"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/TrEMBL:B1K338"
FT                   /protein_id="ACA92692.1"
FT                   /translation="MTEPGVNELNAVLARVPSVERVLSSAPLQPLVADYGRTRVLNAVR
FT                   AELERWRTAAQRDPAAAEPLDEPRIAAAVARTLAAQNAGAVRTVFNLTGTVLHTNLGRA
FT                   LLPDDAVRAVVDVLTRPVNLEFDLATGRRGDRDDLIDALLCELTGAEAATVVNNNAAAV
FT                   LLTLSALATKREVVVSRGELVEIGGAFRIPDIMSRAGAKLREVGTTNRTHLRDYADAIG
FT                   PRTALLMKVHCSNYAISGFTKEATLAELAPLAREHGVPVAVDLGSGTLADLSQWGLPHE
FT                   TTVQETVAAGANVVTFSGDKLLGGPQAGLIVGDRALIAKIKKHPLKRALRVGKLTLAAL
FT                   EPVLRLYQSPEFLRERLTTLRLLTRPQREIAEAAERVRPALQAAFGSGFDVTVEPMFSQ
FT                   IGSGALPVDQLPSAGLVVRSADGKRSGRALAQLEKRLREWPRPVIGRVADNALRLDLRC
FT                   LEAADEAAFVAQCVPLAGPAA"
     MTEPGVNELN AVLARVPSVE RVLSSAPLQP LVADYGRTRV LNAVRAELER WRTAAQRDPA        60
     AAEPLDEPRI AAAVARTLAA QNAGAVRTVF NLTGTVLHTN LGRALLPDDA VRAVVDVLTR       120
     PVNLEFDLAT GRRGDRDDLI DALLCELTGA EAATVVNNNA AAVLLTLSAL ATKREVVVSR       180
     GELVEIGGAF RIPDIMSRAG AKLREVGTTN RTHLRDYADA IGPRTALLMK VHCSNYAISG       240
     FTKEATLAEL APLAREHGVP VAVDLGSGTL ADLSQWGLPH ETTVQETVAA GANVVTFSGD       300
     KLLGGPQAGL IVGDRALIAK IKKHPLKRAL RVGKLTLAAL EPVLRLYQSP EFLRERLTTL       360
     RLLTRPQREI AEAAERVRPA LQAAFGSGFD VTVEPMFSQI GSGALPVDQL PSAGLVVRSA       420
     DGKRSGRALA QLEKRLREWP RPVIGRVADN ALRLDLRCLE AADEAAFVAQ CVPLAGPAA        479
//

If you have problems or comments...

PBIL Back to PBIL home page