(data stored in ACNUC1104 zone)

EMBL: CP000959.PE355

CP000959.PE355       Location/Qualifiers
FT   CDS             complement(420113..422545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3544"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, alpha subunit; PFAM:
FT                   molydopterin dinucleotide-binding region; KEGG:
FT                   bur:Bcep18194_B2100 formate dehydrogenase, alpha subunit,
FT                   anaerobic"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3544"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92696"
FT                   /db_xref="GOA:B1K342"
FT                   /db_xref="InterPro:IPR006443"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:B1K342"
FT                   /protein_id="ACA92696.1"
FT                   /translation="MTNHWVDIKNADVILVMGGNAAEAHPCGFKWVTEAKAHRKARLIV
FT                   VDPRFTRTASVADYYAPIRTGTDIVFLGGVINYLLTNDKIQHEYVKNYTDFSFIVREDF
FT                   AFNDGIYSGYDAEKHAYPDKSSWDYERGDDGFAKVDPTLQHPRCVYNLLKQHYARYTAE
FT                   MVQQVCGTPKEKFLKVCEMLATTAVPGRAGTVLYALGWTHHSIGAQIIRTGAMVQLLLG
FT                   NIGIAGGGMNALRGHSNIQGLTDLGLMSNLLPGYMTLPMQAEQDFDAYIKKRVQQPLRP
FT                   NQLSYWKNYKAFHVSFMKSWWGDAATAENNWAYDYLPKLDKQYDLLQAIELMNAGKMNG
FT                   YICQGFNPLAAAPSKVKTAAGLAKLKWLVIMDPLATETSEFWKHHGDYNDVDASKIQTE
FT                   VFRLPTTCFAEENGSLVSSSRVLQWHWKGAEPPGEARSDLEIMSGLFLRMRKLYQKDGG
FT                   KYPDPIVNLTWPYANPESPTPEELAMEFNGKALADLPDPKDPAKTLVKKGEQLAAFAQL
FT                   KDDGTTASGCWIFCGAWTQAGNQMGRRDNSDPTGIGQTLNWAWAWPANRRILYNRASCD
FT                   VAGKPFDPTRKLIGWNGSAWKGADVPDFKADEPPENGMGPFIMNPEGVARFFARAGMNE
FT                   GPFPEHYEPFETPLGANPLHPNNPLALNNPAARVFPDDRASFGKVADFPHVATTYRLTE
FT                   HFHYWTKHARLNAIIQPEQFVEIGEDLAKEVGVAHGERVKVSSKRGYIIAVALVTKRIK
FT                   PLTVDGKKVQTVGVPLHWGFKGLTKPGYLANTLTPSVGDGNSYTPEFKSFLVKVEKA"
     MTNHWVDIKN ADVILVMGGN AAEAHPCGFK WVTEAKAHRK ARLIVVDPRF TRTASVADYY        60
     APIRTGTDIV FLGGVINYLL TNDKIQHEYV KNYTDFSFIV REDFAFNDGI YSGYDAEKHA       120
     YPDKSSWDYE RGDDGFAKVD PTLQHPRCVY NLLKQHYARY TAEMVQQVCG TPKEKFLKVC       180
     EMLATTAVPG RAGTVLYALG WTHHSIGAQI IRTGAMVQLL LGNIGIAGGG MNALRGHSNI       240
     QGLTDLGLMS NLLPGYMTLP MQAEQDFDAY IKKRVQQPLR PNQLSYWKNY KAFHVSFMKS       300
     WWGDAATAEN NWAYDYLPKL DKQYDLLQAI ELMNAGKMNG YICQGFNPLA AAPSKVKTAA       360
     GLAKLKWLVI MDPLATETSE FWKHHGDYND VDASKIQTEV FRLPTTCFAE ENGSLVSSSR       420
     VLQWHWKGAE PPGEARSDLE IMSGLFLRMR KLYQKDGGKY PDPIVNLTWP YANPESPTPE       480
     ELAMEFNGKA LADLPDPKDP AKTLVKKGEQ LAAFAQLKDD GTTASGCWIF CGAWTQAGNQ       540
     MGRRDNSDPT GIGQTLNWAW AWPANRRILY NRASCDVAGK PFDPTRKLIG WNGSAWKGAD       600
     VPDFKADEPP ENGMGPFIMN PEGVARFFAR AGMNEGPFPE HYEPFETPLG ANPLHPNNPL       660
     ALNNPAARVF PDDRASFGKV ADFPHVATTY RLTEHFHYWT KHARLNAIIQ PEQFVEIGED       720
     LAKEVGVAHG ERVKVSSKRG YIIAVALVTK RIKPLTVDGK KVQTVGVPLH WGFKGLTKPG       780
     YLANTLTPSV GDGNSYTPEF KSFLVKVEKA                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page