(data stored in ACNUC1104 zone)

EMBL: CP000959.PE36

CP000959.PE36        Location/Qualifiers
FT   CDS             39830..41812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3221"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: bam:Bamb_3714
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3221"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92377"
FT                   /db_xref="GOA:B1K897"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:B1K897"
FT                   /protein_id="ACA92377.1"
FT                   /translation="MRMTQLGRVSVGARLAALACALVALLFTVFAWTLAHFAGQQLADE
FT                   AHKRIDDKEQSIRAMVDLFDKALTAEANRSMSLFASFLPADFSLDPARTVDIGGVAAPT
FT                   LLAGGQPLDLDYSIPDQFLKKSGAIATIFARDGDDFVRITTSLKKQDGARAVGTKLDRA
FT                   GPAYAPLVAGRSYTGLAKLFGRSYITQYKPVTDATGRVIGALFVGLDIGAELKLVEDGI
FT                   RALKIGDNGYYFVLDASQGPSRGTFVVHPDAAGQRADDTRAPYAQMLAAAQGRLAYTSA
FT                   DPAAHDAGPTAKFVSFTTIPQWQWLVGGIALDDELLATMRATRNRFLMIGAVLVAAFAT
FT                   LFVIVVRRVVSRPLEAAARASERYAAGDLSVRIRDGAAAHGSAANDEIGRLVQAVDGIG
FT                   DGLARIVAQVRNGAADIAHGTVGIAAGSGDIAARIATQASSVEQTAASMEQITAAVQQS
FT                   AEHAAQANALVADASAAATNGDAAVQRVVATMDDIGRATRRIAEITGAIEGIAFQTNIL
FT                   ALNAAVEAARAGEHGKGFAVVAAEVRALAQRSAAAVKEIDALSAESSTTVEQGYRIADA
FT                   ARGTMRDIVARVDQVRTLIGEISAASREQSTGIEQVNLAVTQIGEATQQNALLISDAER
FT                   AAVALREQAAQLSDAVSVFRLARDA"
     MRMTQLGRVS VGARLAALAC ALVALLFTVF AWTLAHFAGQ QLADEAHKRI DDKEQSIRAM        60
     VDLFDKALTA EANRSMSLFA SFLPADFSLD PARTVDIGGV AAPTLLAGGQ PLDLDYSIPD       120
     QFLKKSGAIA TIFARDGDDF VRITTSLKKQ DGARAVGTKL DRAGPAYAPL VAGRSYTGLA       180
     KLFGRSYITQ YKPVTDATGR VIGALFVGLD IGAELKLVED GIRALKIGDN GYYFVLDASQ       240
     GPSRGTFVVH PDAAGQRADD TRAPYAQMLA AAQGRLAYTS ADPAAHDAGP TAKFVSFTTI       300
     PQWQWLVGGI ALDDELLATM RATRNRFLMI GAVLVAAFAT LFVIVVRRVV SRPLEAAARA       360
     SERYAAGDLS VRIRDGAAAH GSAANDEIGR LVQAVDGIGD GLARIVAQVR NGAADIAHGT       420
     VGIAAGSGDI AARIATQASS VEQTAASMEQ ITAAVQQSAE HAAQANALVA DASAAATNGD       480
     AAVQRVVATM DDIGRATRRI AEITGAIEGI AFQTNILALN AAVEAARAGE HGKGFAVVAA       540
     EVRALAQRSA AAVKEIDALS AESSTTVEQG YRIADAARGT MRDIVARVDQ VRTLIGEISA       600
     ASREQSTGIE QVNLAVTQIG EATQQNALLI SDAERAAVAL REQAAQLSDA VSVFRLARDA       660
//

If you have problems or comments...

PBIL Back to PBIL home page