(data stored in ACNUC1104 zone)

EMBL: CP000959.PE360

CP000959.PE360       Location/Qualifiers
FT   CDS             complement(426870..427853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3549"
FT                   /product="3'-adenylyltransferase"
FT                   /EC_number="2.7.7.47"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: bur:Bcep18194_B2105 streptomycin
FT                   3''-adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3549"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92701"
FT                   /db_xref="GOA:B1K347"
FT                   /db_xref="InterPro:IPR025184"
FT                   /db_xref="UniProtKB/TrEMBL:B1K347"
FT                   /protein_id="ACA92701.1"
FT                   /translation="MSRICIPIAERRASFARRMSVSVRLGKTLGIVGESGSGKSTRAMA
FT                   LPGCCFFALRRARIARFAVVTDFIPHDIAAQLAAARAVIERHLGATLQAVHLFGSALDG
FT                   GLKPSSDIDWLVTVAVRPDEAVRHALMSDLLGASAPPGCSGGMRALEVTVVAHGDGVPW
FT                   RHPARRELQFGEWLRGDLEAGIVEPPLVDHDLAILLTKARQHGVALVGPPADVLFEPVP
FT                   ARDFVAALRATVAQWEAEPDWRGDACNIVLALARIWYSAATGAIAPKDVAATWVLERLP
FT                   DVHRPIVAAARAAYLDGEAGAAILLGAPLAEFIGYARRTVESMLSA"
     MSRICIPIAE RRASFARRMS VSVRLGKTLG IVGESGSGKS TRAMALPGCC FFALRRARIA        60
     RFAVVTDFIP HDIAAQLAAA RAVIERHLGA TLQAVHLFGS ALDGGLKPSS DIDWLVTVAV       120
     RPDEAVRHAL MSDLLGASAP PGCSGGMRAL EVTVVAHGDG VPWRHPARRE LQFGEWLRGD       180
     LEAGIVEPPL VDHDLAILLT KARQHGVALV GPPADVLFEP VPARDFVAAL RATVAQWEAE       240
     PDWRGDACNI VLALARIWYS AATGAIAPKD VAATWVLERL PDVHRPIVAA ARAAYLDGEA       300
     GAAILLGAPL AEFIGYARRT VESMLSA                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page