(data stored in ACNUC1104 zone)

EMBL: CP000959.PE361

CP000959.PE361       Location/Qualifiers
FT   CDS             complement(428020..428469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3550"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: bur:Bcep18194_B2106 histone-like DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3550"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92702"
FT                   /db_xref="GOA:B1K348"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:B1K348"
FT                   /protein_id="ACA92702.1"
FT                   /translation="MATSAKKVAKKAAAPATKKVAAKKAAPAKKVVAKKAVAKAAPAAP
FT                   TPLKDKFTKASLATHIAERAAVEVKAVKAVLVALENVVLGSVHKKGAGEFTLPGLLKIT
FT                   AQVVPAKKKRFGKDPFTGEERWFPAKPASVRVKARALKKLKDAAA"
     MATSAKKVAK KAAAPATKKV AAKKAAPAKK VVAKKAVAKA APAAPTPLKD KFTKASLATH        60
     IAERAAVEVK AVKAVLVALE NVVLGSVHKK GAGEFTLPGL LKITAQVVPA KKKRFGKDPF       120
     TGEERWFPAK PASVRVKARA LKKLKDAAA                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page