(data stored in ACNUC1104 zone)

EMBL: CP000959.PE364

CP000959.PE364       Location/Qualifiers
FT   CDS             complement(431346..431489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_4478 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3553"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92705"
FT                   /db_xref="UniProtKB/TrEMBL:B1K351"
FT                   /protein_id="ACA92705.1"
FT                   /translation="MDMHWIASAAVLLVMAVLSAYREALKNEPIRPGLERGGVPYIEEF
FT                   ES"
     MDMHWIASAA VLLVMAVLSA YREALKNEPI RPGLERGGVP YIEEFES                      47
//

If you have problems or comments...

PBIL Back to PBIL home page