(data stored in ACNUC1104 zone)

EMBL: CP000959.PE367

CP000959.PE367       Location/Qualifiers
FT   CDS             complement(435725..437191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3556"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: multi antimicrobial extrusion protein MatE;
FT                   polysaccharide biosynthesis protein; KEGG: bam:Bamb_3362
FT                   polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3556"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92708"
FT                   /db_xref="GOA:B1K354"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:B1K354"
FT                   /protein_id="ACA92708.1"
FT                   /translation="MDKGILKNVSINFIGLILPTFVSLVTVPAYIHALGVERYGVVSLV
FT                   WTLIGYFGILDLGMSMAAQNHISKALASGNADESARVFWSAFWLNLGTGIAGGLLIYFG
FT                   AFVYTAYFTKVSAAMQHEVYLALPWLALAIPLANVSWVFAGAINGAERFGVFNTNQTIG
FT                   TFLFQLLPLAAAWWIAPNLQTVLAAAVVARLIAAVMLGQASIKVLGIRRIDPPQWGTAK
FT                   GLFNFGGWMLIASTTSMIADTLDRVMLGAGMGAKFVTYYTVPQNLVTRLNMLPNALVRT
FT                   LFPRLSAVGRDHADTLARQSLEFLNGVFTPVGIVAIFALAPFLTLWVGVDLAAHSAPVG
FT                   RVLVISVWLVGQASVTRILIQSQVNPARAAFAGLVEMPFFVGGLWFGIHHFGLIGAAVV
FT                   VAARALVDYGVLLYLSAIRMRAIVLDMLAHLAFLLASLFLAQAWSGLGESIGMCAVVLV
FT                   LNVAWSLTMTPGLRALVRDLFVRLNARKTI"
     MDKGILKNVS INFIGLILPT FVSLVTVPAY IHALGVERYG VVSLVWTLIG YFGILDLGMS        60
     MAAQNHISKA LASGNADESA RVFWSAFWLN LGTGIAGGLL IYFGAFVYTA YFTKVSAAMQ       120
     HEVYLALPWL ALAIPLANVS WVFAGAINGA ERFGVFNTNQ TIGTFLFQLL PLAAAWWIAP       180
     NLQTVLAAAV VARLIAAVML GQASIKVLGI RRIDPPQWGT AKGLFNFGGW MLIASTTSMI       240
     ADTLDRVMLG AGMGAKFVTY YTVPQNLVTR LNMLPNALVR TLFPRLSAVG RDHADTLARQ       300
     SLEFLNGVFT PVGIVAIFAL APFLTLWVGV DLAAHSAPVG RVLVISVWLV GQASVTRILI       360
     QSQVNPARAA FAGLVEMPFF VGGLWFGIHH FGLIGAAVVV AARALVDYGV LLYLSAIRMR       420
     AIVLDMLAHL AFLLASLFLA QAWSGLGESI GMCAVVLVLN VAWSLTMTPG LRALVRDLFV       480
     RLNARKTI                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page