(data stored in ACNUC1104 zone)

EMBL: CP000959.PE371

CP000959.PE371       Location/Qualifiers
FT   CDS             442006..442971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3560"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: bur:Bcep18194_B2116 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3560"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92712"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1K358"
FT                   /protein_id="ACA92712.1"
FT                   /translation="MTRSETGRPSRRAFVTGLTGFTGRYMAERLQAAGYDVWGTVAPGA
FT                   PRPADPAFAHCTLLPADLLDAEAMRAAAADARPDAVVHLAARAHVAQDEPSQTYAVNIV
FT                   GTRNLLAALAGLDRRPSAVLLASSANVYGNSTAGVLDETVAPAPANDYAVSKLAMEYAA
FT                   KLWTDRLPIVIARPFNYTGVGQSDAYLLPKLVAHYASNAPRISLGNLDVSRDFSDVRDV
FT                   TAAYLKLIEAAPAGETFNVCSERAYSLKEVLAMLSRIAGYVIDVTIDPRFVRHNEVKSL
FT                   SGSRDKLRRAVGELPVTPLDETLRWMVDAVRAAPPGHAAG"
     MTRSETGRPS RRAFVTGLTG FTGRYMAERL QAAGYDVWGT VAPGAPRPAD PAFAHCTLLP        60
     ADLLDAEAMR AAAADARPDA VVHLAARAHV AQDEPSQTYA VNIVGTRNLL AALAGLDRRP       120
     SAVLLASSAN VYGNSTAGVL DETVAPAPAN DYAVSKLAME YAAKLWTDRL PIVIARPFNY       180
     TGVGQSDAYL LPKLVAHYAS NAPRISLGNL DVSRDFSDVR DVTAAYLKLI EAAPAGETFN       240
     VCSERAYSLK EVLAMLSRIA GYVIDVTIDP RFVRHNEVKS LSGSRDKLRR AVGELPVTPL       300
     DETLRWMVDA VRAAPPGHAA G                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page