(data stored in ACNUC1104 zone)

EMBL: CP000959.PE372

CP000959.PE372       Location/Qualifiers
FT   CDS             complement(443092..444381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3561"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron maturase-specific domain
FT                   protein; KEGG: bxe:Bxe_A2660 putative reverse
FT                   transcriptase-maturase-endonucleas"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3561"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92713"
FT                   /db_xref="GOA:B1K359"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:B1K359"
FT                   /protein_id="ACA92713.1"
FT                   /translation="MPVSDEGCCPRHESGDTGSSLLMAALTRENLKQAFKRVRANKGAA
FT                   GVDGLDIDQTSRHLVTAWPAIREQLLKGTYRPSPVRRVTIPKPDGGERELGIPTVTDRL
FT                   IQQALLQVLQPVLDPGFSEHSYGFRPGRRAHDAVLAAQSYVQSGRRIVVDVDLEKFFDR
FT                   VNHDILIDRLQKRIGDASVIRLIRAYLNSGIMDGGVVQQREQGTPQGGPLSPLLANVLL
FT                   DEVDKELERRGHCFARYADDANVYVRSRRAGERVMALLRRLYGQLRLKVNETKSAVASV
FT                   FGRKFLGYSLWVASGGVIKRKVAARALLAFKRRIRELTGRSGGRSMKDVVERLRPYVLG
FT                   WKAYFRMAQTPRVWLDLDKWMRHRLRVIQLKHWRRGPTIYRELRALGAPSAVAQQVAAN
FT                   SCRWWRNSGKLLNSVLTLAYFDRLGVPRLS"
     MPVSDEGCCP RHESGDTGSS LLMAALTREN LKQAFKRVRA NKGAAGVDGL DIDQTSRHLV        60
     TAWPAIREQL LKGTYRPSPV RRVTIPKPDG GERELGIPTV TDRLIQQALL QVLQPVLDPG       120
     FSEHSYGFRP GRRAHDAVLA AQSYVQSGRR IVVDVDLEKF FDRVNHDILI DRLQKRIGDA       180
     SVIRLIRAYL NSGIMDGGVV QQREQGTPQG GPLSPLLANV LLDEVDKELE RRGHCFARYA       240
     DDANVYVRSR RAGERVMALL RRLYGQLRLK VNETKSAVAS VFGRKFLGYS LWVASGGVIK       300
     RKVAARALLA FKRRIRELTG RSGGRSMKDV VERLRPYVLG WKAYFRMAQT PRVWLDLDKW       360
     MRHRLRVIQL KHWRRGPTIY RELRALGAPS AVAQQVAANS CRWWRNSGKL LNSVLTLAYF       420
     DRLGVPRLS                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page