(data stored in ACNUC1104 zone)

EMBL: CP000959.PE373

CP000959.PE373       Location/Qualifiers
FT   CDS             complement(444928..446118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3562"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /EC_number="2.5.1.48"
FT                   /note="KEGG: bmu:Bmul_4614 O-succinylhomoserine
FT                   sulfhydrylase; TIGRFAM: O-succinylhomoserine sulfhydrylase;
FT                   PFAM: Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   protein; aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3562"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92714"
FT                   /db_xref="GOA:B1K360"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B1K360"
FT                   /protein_id="ACA92714.1"
FT                   /translation="MDDSLNFDTLAVRAGTLRSDFNEHSEALFLTSSFCFSSAADAAER
FT                   FANSEDYFTYSRFTNPTVTMFQERLAALEGGEACIATASGMAAIMSVVMSALQAGDHLV
FT                   SSRSLFGSTLGMFSQIFSKFGITTTFVDPTDLNAWQEAVRPETKMFFLETPSNPLTELA
FT                   DIEAIGKIAKAANALFVVDNCFCSPVLQQPLKLGADVVMHSATKFLDGQGRVLGGALVG
FT                   SKEFIMGKVFPFVRSAGPTLSAFNAWVLLKGMETLSLRVEKQSANALEIARWLDSHPAV
FT                   ARVFYPGLESHPQHELAKRQQKAGGAIVSFELKGDTPEQQRANAWRVIDGTKLVSITGN
FT                   LGDTRTTITHPATTTHGRITPEARAAAGITEGLIRLAVGLEHAGDIRNDLARGLDG"
     MDDSLNFDTL AVRAGTLRSD FNEHSEALFL TSSFCFSSAA DAAERFANSE DYFTYSRFTN        60
     PTVTMFQERL AALEGGEACI ATASGMAAIM SVVMSALQAG DHLVSSRSLF GSTLGMFSQI       120
     FSKFGITTTF VDPTDLNAWQ EAVRPETKMF FLETPSNPLT ELADIEAIGK IAKAANALFV       180
     VDNCFCSPVL QQPLKLGADV VMHSATKFLD GQGRVLGGAL VGSKEFIMGK VFPFVRSAGP       240
     TLSAFNAWVL LKGMETLSLR VEKQSANALE IARWLDSHPA VARVFYPGLE SHPQHELAKR       300
     QQKAGGAIVS FELKGDTPEQ QRANAWRVID GTKLVSITGN LGDTRTTITH PATTTHGRIT       360
     PEARAAAGIT EGLIRLAVGL EHAGDIRNDL ARGLDG                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page