(data stored in ACNUC1104 zone)

EMBL: CP000959.PE375

CP000959.PE375       Location/Qualifiers
FT   CDS             complement(447963..448457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3564"
FT                   /product="Colicin V production protein"
FT                   /note="PFAM: Colicin V production protein; KEGG:
FT                   bur:Bcep18194_B2119 colicin V production protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3564"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92716"
FT                   /db_xref="GOA:B1K362"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:B1K362"
FT                   /protein_id="ACA92716.1"
FT                   /translation="MLTAFDYAVLAVIVLSALRGAWRGFVSEIFGLIGWIAAIVIASRY
FT                   VGLVVPYIPANWPGGALTQWVIAFALLVIGVVLVAGVANALLSRIAQASGLGGVDRSLG
FT                   MMFGLVRGCVLVVLLVAAAGLTELPKQDFWRNALLRPFAEQGVHELKQLLPDGMAQYVR
FT                   V"
     MLTAFDYAVL AVIVLSALRG AWRGFVSEIF GLIGWIAAIV IASRYVGLVV PYIPANWPGG        60
     ALTQWVIAFA LLVIGVVLVA GVANALLSRI AQASGLGGVD RSLGMMFGLV RGCVLVVLLV       120
     AAAGLTELPK QDFWRNALLR PFAEQGVHEL KQLLPDGMAQ YVRV                        164
//

If you have problems or comments...

PBIL Back to PBIL home page