(data stored in ACNUC1104 zone)

EMBL: CP000959.PE377

CP000959.PE377       Location/Qualifiers
FT   CDS             complement(449331..450641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3566"
FT                   /product="FolC bifunctional protein"
FT                   /note="TIGRFAM: FolC bifunctional protein; PFAM: Mur ligase
FT                   middle domain protein; KEGG: bur:Bcep18194_B2121
FT                   folylpolyglutamate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3566"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92718"
FT                   /db_xref="GOA:B1K364"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B1K364"
FT                   /protein_id="ACA92718.1"
FT                   /translation="MSTFPTLDAWLSHLERAHPVGIDMGLTRIGQVKAALQLEFACPVI
FT                   TVGGTNGKGSTCAFLETILVRAGYKVGCHTSPHLLEFNERARVNGQNVTDDELLPHFEA
FT                   VEAARTSLAEPVSLTYFEFTTLAILHLFASRGLDAVILEVGLGGRLDAVNIIDTDCAIV
FT                   TSIDIDHTEYLGDTREKIAFEKAGIFRAGKPAICGDPAAPQTLIDHAEAIGADLWLVGR
FT                   DFRYEAQAGAERQQWSYLGREKRYPALAYPALRGANQLINASAALAALEALRPVLPVSA
FT                   QDIRLGLANVELPGRFQVLPGKPAIVLDVAHNPHASAVLEQNLGNMGFFPYTYAVFGAM
FT                   HDKDIDGVLQHLKGEIDHWCVTDLPLPRAASAEQLEAALRKAGVEEGPDSSVTRYASPA
FT                   EAFRDALKRASENDRIVVFGSFHTVAGVLAYRKSQQH"
     MSTFPTLDAW LSHLERAHPV GIDMGLTRIG QVKAALQLEF ACPVITVGGT NGKGSTCAFL        60
     ETILVRAGYK VGCHTSPHLL EFNERARVNG QNVTDDELLP HFEAVEAART SLAEPVSLTY       120
     FEFTTLAILH LFASRGLDAV ILEVGLGGRL DAVNIIDTDC AIVTSIDIDH TEYLGDTREK       180
     IAFEKAGIFR AGKPAICGDP AAPQTLIDHA EAIGADLWLV GRDFRYEAQA GAERQQWSYL       240
     GREKRYPALA YPALRGANQL INASAALAAL EALRPVLPVS AQDIRLGLAN VELPGRFQVL       300
     PGKPAIVLDV AHNPHASAVL EQNLGNMGFF PYTYAVFGAM HDKDIDGVLQ HLKGEIDHWC       360
     VTDLPLPRAA SAEQLEAALR KAGVEEGPDS SVTRYASPAE AFRDALKRAS ENDRIVVFGS       420
     FHTVAGVLAY RKSQQH                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page