(data stored in ACNUC1104 zone)

EMBL: CP000959.PE38

CP000959.PE38        Location/Qualifiers
FT   CDS             43676..44419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3223"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG:
FT                   bur:Bcep18194_B1725 cyclic nucleotide-binding domain
FT                   (cNMP-BD) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3223"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92379"
FT                   /db_xref="GOA:B1K899"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K899"
FT                   /protein_id="ACA92379.1"
FT                   /translation="MHDHPDAAAAPADTPPAPGPLPPLATLFGQCAWFRTLAPEHQARV
FT                   LAESHVAQCEAGDVIAHRLAPSEYWIGVHQGLLKLAIFNVSGRGCTFSGVPSGGWFGEG
FT                   SVIKRELRKYEVVAIQRSTVLFVPVDTFHALLDTSLPFTRFVIHQLNNRMGEFIASIQN
FT                   SRLLDVDARVAQALAQLFNPALYPDTGPSLSISQEELGMLVGVSRQRINQALQQLEKLG
FT                   ALRLAYNQIEVVDLDALARFGMEQL"
     MHDHPDAAAA PADTPPAPGP LPPLATLFGQ CAWFRTLAPE HQARVLAESH VAQCEAGDVI        60
     AHRLAPSEYW IGVHQGLLKL AIFNVSGRGC TFSGVPSGGW FGEGSVIKRE LRKYEVVAIQ       120
     RSTVLFVPVD TFHALLDTSL PFTRFVIHQL NNRMGEFIAS IQNSRLLDVD ARVAQALAQL       180
     FNPALYPDTG PSLSISQEEL GMLVGVSRQR INQALQQLEK LGALRLAYNQ IEVVDLDALA       240
     RFGMEQL                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page