(data stored in ACNUC1104 zone)

EMBL: CP000959.PE380

CP000959.PE380       Location/Qualifiers
FT   CDS             complement(452583..453434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3569"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   bur:Bcep18194_B2124 DNA methylase N-4/N-6"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3569"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92721"
FT                   /db_xref="GOA:B1K367"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1K367"
FT                   /protein_id="ACA92721.1"
FT                   /translation="MRDLIEEPGGGAASEAEAVQPAAAAPRALPSGIELHNRDFLTHAA
FT                   YLPDASIDLIVADPPYGLGKDYGNDSDKRSGDDFLAWTRGWLELAIPKLKPSGSMYIFC
FT                   TWQYAPEIFSFLKTQLTMVNEIIWDRRVPSMGGTTRRFTSVHDNIGFFAVSKAYYFDLD
FT                   PVRIPYDADTKKARSRKLFEGSKWLEMGYNPKDVWSVSRLHRQHAERVDHPTQKPLEII
FT                   ERMVLASCPPGGRVLDPFMGSGTTAVACARQGRDFVGYEINESYCAIAHERVSALAAPA
FT                   CA"
     MRDLIEEPGG GAASEAEAVQ PAAAAPRALP SGIELHNRDF LTHAAYLPDA SIDLIVADPP        60
     YGLGKDYGND SDKRSGDDFL AWTRGWLELA IPKLKPSGSM YIFCTWQYAP EIFSFLKTQL       120
     TMVNEIIWDR RVPSMGGTTR RFTSVHDNIG FFAVSKAYYF DLDPVRIPYD ADTKKARSRK       180
     LFEGSKWLEM GYNPKDVWSV SRLHRQHAER VDHPTQKPLE IIERMVLASC PPGGRVLDPF       240
     MGSGTTAVAC ARQGRDFVGY EINESYCAIA HERVSALAAP ACA                         283
//

If you have problems or comments...

PBIL Back to PBIL home page