(data stored in ACNUC1104 zone)

EMBL: CP000959.PE381

CP000959.PE381       Location/Qualifiers
FT   CDS             complement(453444..454637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3570"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /note="TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: bur:Bcep18194_B2125 tryptophan synthase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3570"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92722"
FT                   /db_xref="GOA:B1K368"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B1K368"
FT                   /protein_id="ACA92722.1"
FT                   /translation="MYNLPDDRGHFGPYGGVFVAETLIHALDELRAAYEKFQNDPDFVA
FT                   EFERELKYFVGRPSPIYHAQRWSEMLGGAQIYLKREDLNHTGAHKINNVIGQALLAKRM
FT                   GKKRVIAETGAGQHGVATATICARFGMECVVYMGSEDVRRQAANVYRMKLLGATVVPVE
FT                   SGSRTLKDALNEAMRDWVTNIESTFYIIGTVAGPHPYPMMVRDFQRVIGDECKVQMPEL
FT                   AGRQPDAVIACVGGGSNAMGIFYPYIDDTSVQLIGVEAAGDGLDTGHHAASLIAGSPGV
FT                   LHGNRTYLLQDDNGQIIETHSVSAGLDYPGVGPEHAWLKDSGRAQYVPITDAEALKAFH
FT                   DCCRIEGIIPALESSHAIAYGVKLAPTLPKDKLLLVNLSGRGDKDMHTVAERSGIEL"
     MYNLPDDRGH FGPYGGVFVA ETLIHALDEL RAAYEKFQND PDFVAEFERE LKYFVGRPSP        60
     IYHAQRWSEM LGGAQIYLKR EDLNHTGAHK INNVIGQALL AKRMGKKRVI AETGAGQHGV       120
     ATATICARFG MECVVYMGSE DVRRQAANVY RMKLLGATVV PVESGSRTLK DALNEAMRDW       180
     VTNIESTFYI IGTVAGPHPY PMMVRDFQRV IGDECKVQMP ELAGRQPDAV IACVGGGSNA       240
     MGIFYPYIDD TSVQLIGVEA AGDGLDTGHH AASLIAGSPG VLHGNRTYLL QDDNGQIIET       300
     HSVSAGLDYP GVGPEHAWLK DSGRAQYVPI TDAEALKAFH DCCRIEGIIP ALESSHAIAY       360
     GVKLAPTLPK DKLLLVNLSG RGDKDMHTVA ERSGIEL                                397
//

If you have problems or comments...

PBIL Back to PBIL home page