(data stored in ACNUC1104 zone)

EMBL: CP000959.PE384

CP000959.PE384       Location/Qualifiers
FT   CDS             complement(456202..458334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3573"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3573"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92725"
FT                   /db_xref="InterPro:IPR020011"
FT                   /db_xref="InterPro:IPR038440"
FT                   /db_xref="UniProtKB/TrEMBL:B1K371"
FT                   /protein_id="ACA92725.1"
FT                   /translation="MSRIFLFPRQSRLSRAVRGALAILALGVAASAWAVGTGELPASAA
FT                   AAAAPLTVTVQPGQSLNDIAKAATQSHDPAVLARAGRALFDANPQAFMKRDASRLKVGA
FT                   TLTVPALDATGAALVPAGASAASGAAAASAPAAASGGAAIAQHGASAPHPGSTVQPAPV
FT                   APAVHAAPVSGASVATATAAGALASSGASASIGASAAYGASAVESTQPATSTAGASGPH
FT                   VWSGAIQSAPSSASEAAGQAVPGSPVSGVHEPAGAAPAVTASQPRPSSLQQLLALKNRV
FT                   LMELQKHGIGKPATTTGVVPAPAPAAPRPAANDAGASAAASTADEAASGVAASAPQPAS
FT                   ASVQPVAPVATPARRTEQIDWRPAAAAGAAVIVLAAGFAWRKRRKGRRADDAGTVATAT
FT                   AAAGGGAVAAEAEAASSVERELPITPEMPVARDAASDLNLAAATAAAAETIEPPAADTS
FT                   PAPEVTAPRDESPELPPAHAAEPVANEATPVPVEAPHDAEPAEKTTAADQPADPTAASA
FT                   APATTEAQHASLMQNAISALNSLDMPLPPRTADEPSSTAEEPSARAVQSDVDKIATNGQ
FT                   SAQHPPTGASEPAPEHPADQDEEFDWDPDAATPAGQAGSPPVTTSLPPLGGAQFGALKL
FT                   DFDLDLPSTPGAALPALTADELARIARNKLDLAAEYVELGDLSGARTLLQEVIDANDAA
FT                   TRDDARALLAKLADEA"
     MSRIFLFPRQ SRLSRAVRGA LAILALGVAA SAWAVGTGEL PASAAAAAAP LTVTVQPGQS        60
     LNDIAKAATQ SHDPAVLARA GRALFDANPQ AFMKRDASRL KVGATLTVPA LDATGAALVP       120
     AGASAASGAA AASAPAAASG GAAIAQHGAS APHPGSTVQP APVAPAVHAA PVSGASVATA       180
     TAAGALASSG ASASIGASAA YGASAVESTQ PATSTAGASG PHVWSGAIQS APSSASEAAG       240
     QAVPGSPVSG VHEPAGAAPA VTASQPRPSS LQQLLALKNR VLMELQKHGI GKPATTTGVV       300
     PAPAPAAPRP AANDAGASAA ASTADEAASG VAASAPQPAS ASVQPVAPVA TPARRTEQID       360
     WRPAAAAGAA VIVLAAGFAW RKRRKGRRAD DAGTVATATA AAGGGAVAAE AEAASSVERE       420
     LPITPEMPVA RDAASDLNLA AATAAAAETI EPPAADTSPA PEVTAPRDES PELPPAHAAE       480
     PVANEATPVP VEAPHDAEPA EKTTAADQPA DPTAASAAPA TTEAQHASLM QNAISALNSL       540
     DMPLPPRTAD EPSSTAEEPS ARAVQSDVDK IATNGQSAQH PPTGASEPAP EHPADQDEEF       600
     DWDPDAATPA GQAGSPPVTT SLPPLGGAQF GALKLDFDLD LPSTPGAALP ALTADELARI       660
     ARNKLDLAAE YVELGDLSGA RTLLQEVIDA NDAATRDDAR ALLAKLADEA                  710
//

If you have problems or comments...

PBIL Back to PBIL home page