(data stored in ACNUC1104 zone)

EMBL: CP000959.PE388

CP000959.PE388       Location/Qualifiers
FT   CDS             complement(463082..463732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3577"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: bur:Bcep18194_B2132 isopropylmalate isomerase
FT                   small subunit; TIGRFAM: 3-isopropylmalate dehydratase,
FT                   small subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3577"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92729"
FT                   /db_xref="GOA:B1K375"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1K375"
FT                   /protein_id="ACA92729.1"
FT                   /translation="MEKFTVHTGVVAPLDRENVDTDAIIPKQFLKSIKRTGFGPNAFDE
FT                   WRYLDHGEPGQDNSKRPLNPDFVLNQPRYQGASVLLARKNFGCGSSREHAPWALQQYGF
FT                   RAIIAPSFADIFFNNCYKNGLLPIVLTEQQVDHLFNETVAFNGFQLTIDLDAQVVRAGD
FT                   GREYPFEIAAFRKYCLLNGFDDIGLTLRHADKIRQFEAERLVKQPWLNTKLVG"
     MEKFTVHTGV VAPLDRENVD TDAIIPKQFL KSIKRTGFGP NAFDEWRYLD HGEPGQDNSK        60
     RPLNPDFVLN QPRYQGASVL LARKNFGCGS SREHAPWALQ QYGFRAIIAP SFADIFFNNC       120
     YKNGLLPIVL TEQQVDHLFN ETVAFNGFQL TIDLDAQVVR AGDGREYPFE IAAFRKYCLL       180
     NGFDDIGLTL RHADKIRQFE AERLVKQPWL NTKLVG                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page