(data stored in ACNUC1104 zone)

EMBL: CP000959.PE393

CP000959.PE393       Location/Qualifiers
FT   CDS             467682..468407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3582"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bur:Bcep18194_B2137 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3582"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92734"
FT                   /db_xref="GOA:B1K380"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:B1K380"
FT                   /protein_id="ACA92734.1"
FT                   /translation="MQYELYYWPEIQGRGEYVRLALEAAEADYVDVARESGRGMGVSAM
FT                   MRMMDSAKAECVPFAPPFLKAGDVVVGQTANILLFLGARLGLAPDDEAGRLWVHQIQLT
FT                   AADFVTEIHDTHHPIGSGLYYEEQQAEAAERAADFLENRLPKFLGYFDRLLEQNPHKSG
FT                   YIAGSALTYADLTMFQLIEGLRYAFPKAMKRAERKVAALVALHDRVAQHPPVARYLESE
FT                   RRIPFNDMGIFRHYPELDK"
     MQYELYYWPE IQGRGEYVRL ALEAAEADYV DVARESGRGM GVSAMMRMMD SAKAECVPFA        60
     PPFLKAGDVV VGQTANILLF LGARLGLAPD DEAGRLWVHQ IQLTAADFVT EIHDTHHPIG       120
     SGLYYEEQQA EAAERAADFL ENRLPKFLGY FDRLLEQNPH KSGYIAGSAL TYADLTMFQL       180
     IEGLRYAFPK AMKRAERKVA ALVALHDRVA QHPPVARYLE SERRIPFNDM GIFRHYPELD       240
     K                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page