(data stored in ACNUC1104 zone)

EMBL: CP000959.PE395

CP000959.PE395       Location/Qualifiers
FT   CDS             complement(470125..470589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3584"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   bur:Bcep18194_B2142 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3584"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92736"
FT                   /db_xref="GOA:B1K382"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K382"
FT                   /protein_id="ACA92736.1"
FT                   /translation="MTDKKMQLDKIDLRILDILRTDGRISYRKLSELVNLTPRPCQARV
FT                   ERLEALGVIEGYRAVIKAPRATKPIVVIAQIVLADHGRSQAPFEEEMRANPAVLDCWLV
FT                   SGTFDFLVRLACEDLDEYRRIANVWLESPRFRIEKIVTTAELQAIKRSVV"
     MTDKKMQLDK IDLRILDILR TDGRISYRKL SELVNLTPRP CQARVERLEA LGVIEGYRAV        60
     IKAPRATKPI VVIAQIVLAD HGRSQAPFEE EMRANPAVLD CWLVSGTFDF LVRLACEDLD       120
     EYRRIANVWL ESPRFRIEKI VTTAELQAIK RSVV                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page