(data stored in ACNUC1104 zone)

EMBL: CP000959.PE397

CP000959.PE397       Location/Qualifiers
FT   CDS             complement(471654..472904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3586"
FT                   /product="protein of unknown function DUF1479"
FT                   /note="PFAM: protein of unknown function DUF1479; KEGG:
FT                   bur:Bcep18194_B2144 protein of unknown function DUF1479"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3586"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92738"
FT                   /db_xref="InterPro:IPR010856"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:B1K384"
FT                   /protein_id="ACA92738.1"
FT                   /translation="MQLTIDDLPAAIRAAKRALRADLPDYAATFREVEGDIARQVDAIR
FT                   RAHAHGQDVIPVVPFADIAGGRVDPHAMAAIRTHGAVVIRGVFDARQARDWNDEIGAYL
FT                   DANRFTERLHARAEDRYFGNLASGKPQIYGVYWSKPQVAARQSPALTQARVFLNRLWRH
FT                   ADGARTHFDPDQVPAYADRIRRRPPGSTSLGLSPHVDGGSVERWLGANFRQVYRHVLAG
FT                   RWRDYDPFDAAFRPDVEEIPSPAVCSMFRTFQGWTALTPQGPGDGTLQLIPVANAMAYV
FT                   VLRALQDDVADDDLCGARPGRALSIRPEWHALLLDALVPIPHMEPGDAVFWHGDVVHAV
FT                   EDAHRGSGDSNVMYIAAAPGCAKNDAYLQRQRVAFLRGDSPPDFPADHFEVDFDGRAQA
FT                   GELTALGRAQMGFAPDA"
     MQLTIDDLPA AIRAAKRALR ADLPDYAATF REVEGDIARQ VDAIRRAHAH GQDVIPVVPF        60
     ADIAGGRVDP HAMAAIRTHG AVVIRGVFDA RQARDWNDEI GAYLDANRFT ERLHARAEDR       120
     YFGNLASGKP QIYGVYWSKP QVAARQSPAL TQARVFLNRL WRHADGARTH FDPDQVPAYA       180
     DRIRRRPPGS TSLGLSPHVD GGSVERWLGA NFRQVYRHVL AGRWRDYDPF DAAFRPDVEE       240
     IPSPAVCSMF RTFQGWTALT PQGPGDGTLQ LIPVANAMAY VVLRALQDDV ADDDLCGARP       300
     GRALSIRPEW HALLLDALVP IPHMEPGDAV FWHGDVVHAV EDAHRGSGDS NVMYIAAAPG       360
     CAKNDAYLQR QRVAFLRGDS PPDFPADHFE VDFDGRAQAG ELTALGRAQM GFAPDA           416
//

If you have problems or comments...

PBIL Back to PBIL home page