(data stored in ACNUC1104 zone)

EMBL: CP000959.PE398

CP000959.PE398       Location/Qualifiers
FT   CDS             complement(473015..473404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3587"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bvi:Bcep1808_4417
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3587"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92739"
FT                   /db_xref="GOA:B1K385"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B1K385"
FT                   /protein_id="ACA92739.1"
FT                   /translation="MFSHVCVGVSDTARAYDFYAPLFAELGLRLKFREPDGWSGWMPAD
FT                   AERPLFFFGKPLDGHPPEPGNGHTIAFDAPTRAHVDRCHALALRQGGTCEGLPGLRPHY
FT                   HRDYYGAYFRDPDGNKLCVVCHRPE"
     MFSHVCVGVS DTARAYDFYA PLFAELGLRL KFREPDGWSG WMPADAERPL FFFGKPLDGH        60
     PPEPGNGHTI AFDAPTRAHV DRCHALALRQ GGTCEGLPGL RPHYHRDYYG AYFRDPDGNK       120
     LCVVCHRPE                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page