(data stored in ACNUC1104 zone)

EMBL: CP000959.PE399

CP000959.PE399       Location/Qualifiers
FT   CDS             473475..474452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3588"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bur:Bcep18194_B2146 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3588"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92740"
FT                   /db_xref="GOA:B1K386"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:B1K386"
FT                   /protein_id="ACA92740.1"
FT                   /translation="MKPQYEHVTFASGCSIRVYHRQLARIPFEWHRHPEYELTLTLNSR
FT                   GQRFIGDHVARYADDDLVLVPPNLPHTWSSNARIDRDAPEVALVVWFDGDWMRRLADCC
FT                   PEYAPLRSLLRRAAPGLHFDVETARAMRARLPRLLDPSPRVRLAATLDTLADLAETGGE
FT                   PLATAQAYDLADGAPSPADPAAPEAERLDRVLDAIDRHFHEPLRIDALAAVAHLSERTL
FT                   QRLFVRHLGESVGRYVQRLRLAHACRHLVGTDWPIATVAARCGIPNTANFNRQFLAARG
FT                   TTPGAYRQFFKQHGHAPDGDAPALDTRPPSLEHRGGSGQRRPHK"
     MKPQYEHVTF ASGCSIRVYH RQLARIPFEW HRHPEYELTL TLNSRGQRFI GDHVARYADD        60
     DLVLVPPNLP HTWSSNARID RDAPEVALVV WFDGDWMRRL ADCCPEYAPL RSLLRRAAPG       120
     LHFDVETARA MRARLPRLLD PSPRVRLAAT LDTLADLAET GGEPLATAQA YDLADGAPSP       180
     ADPAAPEAER LDRVLDAIDR HFHEPLRIDA LAAVAHLSER TLQRLFVRHL GESVGRYVQR       240
     LRLAHACRHL VGTDWPIATV AARCGIPNTA NFNRQFLAAR GTTPGAYRQF FKQHGHAPDG       300
     DAPALDTRPP SLEHRGGSGQ RRPHK                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page