(data stored in ACNUC1104 zone)

EMBL: CP000959.PE40

CP000959.PE40        Location/Qualifiers
FT   CDS             47859..49037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3225"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bur:Bcep18194_B1727 secretion protein, HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3225"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92381"
FT                   /db_xref="GOA:B1K8A1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8A1"
FT                   /protein_id="ACA92381.1"
FT                   /translation="MHLPARASVSRRGRIVLVVIGVLLAAGAARTIVVNVLNQHRLDAV
FT                   AAQNTRQYVSVVHPVDAATGGKLTLPGTLRGFVEAPIYARASGYVLRWQADIGAHVKQG
FT                   QTLAELDTPELNQELAQATAQRQQAQAALALAKTSFDRAQQLRQRDAVSQQELDDRQGA
FT                   FSQGSANLAAADANMRRLTELKGFQRIVAPIDGIVTQRNVDVGDLVNSGNAGRSLFTVV
FT                   QADRLRLYVQVPQAYAQQVKVGQHVSVAQAELPGRTFDGTITRTSQAIDVATRSLQIEI
FT                   TLPNPDGRLLPGAYVQATLPMTPVGRLQVPANTLLFRAEGPTVAAVDANGQVRLKQVTV
FT                   VRTIGQTLEVDGPITPNDRLVANPSDALATGDRVVVQAPAAQPASAVAGAKS"
     MHLPARASVS RRGRIVLVVI GVLLAAGAAR TIVVNVLNQH RLDAVAAQNT RQYVSVVHPV        60
     DAATGGKLTL PGTLRGFVEA PIYARASGYV LRWQADIGAH VKQGQTLAEL DTPELNQELA       120
     QATAQRQQAQ AALALAKTSF DRAQQLRQRD AVSQQELDDR QGAFSQGSAN LAAADANMRR       180
     LTELKGFQRI VAPIDGIVTQ RNVDVGDLVN SGNAGRSLFT VVQADRLRLY VQVPQAYAQQ       240
     VKVGQHVSVA QAELPGRTFD GTITRTSQAI DVATRSLQIE ITLPNPDGRL LPGAYVQATL       300
     PMTPVGRLQV PANTLLFRAE GPTVAAVDAN GQVRLKQVTV VRTIGQTLEV DGPITPNDRL       360
     VANPSDALAT GDRVVVQAPA AQPASAVAGA KS                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page