(data stored in ACNUC1104 zone)

EMBL: CP000959.PE402

CP000959.PE402       Location/Qualifiers
FT   CDS             complement(476190..476891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3591"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; KEGG: bam:Bamb_3314
FT                   succinate dehydrogenase and fumarate reductase iron-sulfur
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3591"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92743"
FT                   /db_xref="GOA:B1K389"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B1K389"
FT                   /protein_id="ACA92743.1"
FT                   /translation="MAKRIFEVYRYDPDKDAAPRMQTYELEIQHERMLLDALVKLKALD
FT                   ETLSFRRSCREGVCGSDAMNINGKNGLACLTNLNDLPQKIVLRPLPGLPVVRDLIVDMT
FT                   HFFNQYHSIKPYLINDAPPPEKERLQSPEERDELDGVYECILCASCSTSCPSFWWNPDK
FT                   FVGPAGLLQAYRFIADSRDTATGERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIG
FT                   KIKELMVRRAV"
     MAKRIFEVYR YDPDKDAAPR MQTYELEIQH ERMLLDALVK LKALDETLSF RRSCREGVCG        60
     SDAMNINGKN GLACLTNLND LPQKIVLRPL PGLPVVRDLI VDMTHFFNQY HSIKPYLIND       120
     APPPEKERLQ SPEERDELDG VYECILCASC STSCPSFWWN PDKFVGPAGL LQAYRFIADS       180
     RDTATGERLD NLEDPYRLFR CHTIMNCVDV CPKGLNPTKA IGKIKELMVR RAV              233
//

If you have problems or comments...

PBIL Back to PBIL home page