(data stored in ACNUC1104 zone)

EMBL: CP000959.PE404

CP000959.PE404       Location/Qualifiers
FT   CDS             complement(478693..479061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3593"
FT                   /product="succinate dehydrogenase, hydrophobic membrane
FT                   anchor protein"
FT                   /note="TIGRFAM: succinate dehydrogenase, hydrophobic
FT                   membrane anchor protein; PFAM: succinate dehydrogenase
FT                   cytochrome b subunit; KEGG: bur:Bcep18194_B2151 succinate
FT                   dehydrogenase, cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3593"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92745"
FT                   /db_xref="GOA:B1K391"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B1K391"
FT                   /protein_id="ACA92745.1"
FT                   /translation="MAANNRIGSKRLVVGAHYGLRDWLAQRVTATIMAVYTVILLVLFF
FT                   GAHDFSYEGWASIFAAQWMKLATFVMLLSLFYHAWVGVRDIWMDYVKPVGVRLLLQSLT
FT                   IVWLLACAGYAAQILWRV"
     MAANNRIGSK RLVVGAHYGL RDWLAQRVTA TIMAVYTVIL LVLFFGAHDF SYEGWASIFA        60
     AQWMKLATFV MLLSLFYHAW VGVRDIWMDY VKPVGVRLLL QSLTIVWLLA CAGYAAQILW       120
     RV                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page