(data stored in ACNUC1104 zone)

EMBL: CP000959.PE406

CP000959.PE406       Location/Qualifiers
FT   CDS             complement(479651..480475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3595"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   bur:Bcep18194_B2153 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3595"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92747"
FT                   /db_xref="GOA:B1K393"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K393"
FT                   /protein_id="ACA92747.1"
FT                   /translation="MRAMTSNQANTANQTGAGGPGQPGAGDPAASPAASASPTFSPLYQ
FT                   QIKSLITQSLESGEWKPGEIIPSEVELAARYKVSQGTVRKAIDELAAENLVVRRQGKGT
FT                   FVATHNEDRAQFRFLRLLADDGAEHPHVSRLLECRRLRAPAEIARQLDLKPADPVVQVR
FT                   RLLEFDSEVTVLDEIWLPGAMFRGLTFERLSEYKGPLYAMFETEFGTRMIRATEKIRAV
FT                   AADPAVADLLHVPAGFPLLSVERVSYTYGDRPVEVRRGWYVTTGYYYQNDLS"
     MRAMTSNQAN TANQTGAGGP GQPGAGDPAA SPAASASPTF SPLYQQIKSL ITQSLESGEW        60
     KPGEIIPSEV ELAARYKVSQ GTVRKAIDEL AAENLVVRRQ GKGTFVATHN EDRAQFRFLR       120
     LLADDGAEHP HVSRLLECRR LRAPAEIARQ LDLKPADPVV QVRRLLEFDS EVTVLDEIWL       180
     PGAMFRGLTF ERLSEYKGPL YAMFETEFGT RMIRATEKIR AVAADPAVAD LLHVPAGFPL       240
     LSVERVSYTY GDRPVEVRRG WYVTTGYYYQ NDLS                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page