(data stored in ACNUC1104 zone)

EMBL: CP000959.PE408

CP000959.PE408       Location/Qualifiers
FT   CDS             481936..482943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3597"
FT                   /product="HpcH/HpaI aldolase"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: bur:Bcep18194_B2155
FT                   citrate lyase beta subunit-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3597"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92749"
FT                   /db_xref="GOA:B1K395"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040186"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B1K395"
FT                   /protein_id="ACA92749.1"
FT                   /translation="MAALTPAQVLYDGASPPAILPCCDHYAGSEKLMRKSLALQAELGP
FT                   VFDLTLDCEDGATVGQEAAHAALVADLLGSAENRFGRVGVRIHDFSHPHWRDDVRIVLR
FT                   ASRAPAYITLPKIANAADAAEMTAFIEGTRRELGIAQPIPVDVLIETHGALAQAAALAA
FT                   LPTVGTLSFGLMDFVSAHHGAIPDSAMRSPGQFDHPLVRRAKLEIAAACHAHGKTPSHN
FT                   VTTEVRDMGVVAGDARRARDEFAFTRMWSIHPAQIRPIVDAFAPRTDEVTLAAEILLAA
FT                   QAADWGPTRHGDTLHDRASYRYYWSVLRRARATGQPVPDEAAPLFGPAAAGAAP"
     MAALTPAQVL YDGASPPAIL PCCDHYAGSE KLMRKSLALQ AELGPVFDLT LDCEDGATVG        60
     QEAAHAALVA DLLGSAENRF GRVGVRIHDF SHPHWRDDVR IVLRASRAPA YITLPKIANA       120
     ADAAEMTAFI EGTRRELGIA QPIPVDVLIE THGALAQAAA LAALPTVGTL SFGLMDFVSA       180
     HHGAIPDSAM RSPGQFDHPL VRRAKLEIAA ACHAHGKTPS HNVTTEVRDM GVVAGDARRA       240
     RDEFAFTRMW SIHPAQIRPI VDAFAPRTDE VTLAAEILLA AQAADWGPTR HGDTLHDRAS       300
     YRYYWSVLRR ARATGQPVPD EAAPLFGPAA AGAAP                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page