(data stored in ACNUC1104 zone)

EMBL: CP000959.PE41

CP000959.PE41        Location/Qualifiers
FT   CDS             49043..50554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3226"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bam:Bamb_3709 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3226"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92382"
FT                   /db_xref="GOA:B1K8N5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8N5"
FT                   /protein_id="ACA92382.1"
FT                   /translation="MRPRVHPAAIGAVAIVAAAVLAGCTVGPDYRRPPVDTPAAWRLDP
FT                   ADAYWQPAAPTRAPLDPAWWTAFGDAQLDALEADALRNNQNLKAMAARYDQAKATLASV
FT                   ASAQYPAVGLNASGQRFKISADRPQTNYATQSMSTVQNEIQVGAAVSYELDLFGRVRRN
FT                   VEAAQASTEQSRDDFANARLVLSADLASSYFTLRELDTEIDVVKRSIDLQQKALDYVSA
FT                   RHDLGAVSGLDLLQQRAQLDATRTQAQLLIQQRAQVETAIATLVGTPAPAFSLPPRVVP
FT                   INAPALPTGMPSDLLQRRPDVASAERAMAAANAQIGVARAAYFPRITLSPDIGWDATRF
FT                   AGLFTVPALLWSVGGSLSQPLFEGGKLKAGVDFAQAGYVAAQASYRQTVLTAFQEVQNA
FT                   VTGLSVLAQAAQQASAAVDDARKLVSLAQDRYAGGLTPFIDVLTAQQQLLTSERQAVQI
FT                   QGQRAALVVFLAKALGGGWDGDAASGPAPSDVASAAPRRDAGVGP"
     MRPRVHPAAI GAVAIVAAAV LAGCTVGPDY RRPPVDTPAA WRLDPADAYW QPAAPTRAPL        60
     DPAWWTAFGD AQLDALEADA LRNNQNLKAM AARYDQAKAT LASVASAQYP AVGLNASGQR       120
     FKISADRPQT NYATQSMSTV QNEIQVGAAV SYELDLFGRV RRNVEAAQAS TEQSRDDFAN       180
     ARLVLSADLA SSYFTLRELD TEIDVVKRSI DLQQKALDYV SARHDLGAVS GLDLLQQRAQ       240
     LDATRTQAQL LIQQRAQVET AIATLVGTPA PAFSLPPRVV PINAPALPTG MPSDLLQRRP       300
     DVASAERAMA AANAQIGVAR AAYFPRITLS PDIGWDATRF AGLFTVPALL WSVGGSLSQP       360
     LFEGGKLKAG VDFAQAGYVA AQASYRQTVL TAFQEVQNAV TGLSVLAQAA QQASAAVDDA       420
     RKLVSLAQDR YAGGLTPFID VLTAQQQLLT SERQAVQIQG QRAALVVFLA KALGGGWDGD       480
     AASGPAPSDV ASAAPRRDAG VGP                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page