(data stored in ACNUC1104 zone)

EMBL: CP000959.PE410

CP000959.PE410       Location/Qualifiers
FT   CDS             483708..485159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3599"
FT                   /product="2-methylcitrate dehydratase"
FT                   /EC_number="4.2.1.79"
FT                   /note="KEGG: bur:Bcep18194_B2157 2-methylcitrate
FT                   dehydratase; TIGRFAM: 2-methylcitrate dehydratase; PFAM:
FT                   MmgE/PrpD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3599"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92751"
FT                   /db_xref="GOA:B1K3N0"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR012705"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3N0"
FT                   /protein_id="ACA92751.1"
FT                   /translation="MSAPVSNVRPAPDSVLVDIVDYVLNTGIDGALALETARHCLIDTL
FT                   GCGLEALSYPACTKLLGPVVPGTIVPNGAKVPGTSFQLDPVQAAFDIGAMIRWLDFNDT
FT                   WLAAEWGHPSDNLGGILATADWLSRTARAAGRKPLAMRDVLVAMIQAHEIQGCLALENS
FT                   FNAVGLDHVLLVKVASTAVVGRLLGLTRDELINAVSNAFVDGHALRTYRHAPNTGSRKS
FT                   WAAGDATSRAVRLALIAKTGEMGYPSALTAKTWGFYDVLFDGKPFRFQRPYGTYVMENV
FT                   LFKIAFPAEFHAQTAAEAALQLHAQLAAAGRTTDDISRITIRTHAAAIRIIDKQGPLAN
FT                   PADRDHCIQYMVAVPLLFGRLTAADYEDAAAADPRIDALRAKTVCVEDPQFTKDYHDPD
FT                   KRSIANALTIAFTDGSKLAEVAVEYPLGHRRRRAEGVPLLVEKFRTNLARRFPAKQQQA
FT                   ILDVSLDQAKLEAMPVDEYVDLYVI"
     MSAPVSNVRP APDSVLVDIV DYVLNTGIDG ALALETARHC LIDTLGCGLE ALSYPACTKL        60
     LGPVVPGTIV PNGAKVPGTS FQLDPVQAAF DIGAMIRWLD FNDTWLAAEW GHPSDNLGGI       120
     LATADWLSRT ARAAGRKPLA MRDVLVAMIQ AHEIQGCLAL ENSFNAVGLD HVLLVKVAST       180
     AVVGRLLGLT RDELINAVSN AFVDGHALRT YRHAPNTGSR KSWAAGDATS RAVRLALIAK       240
     TGEMGYPSAL TAKTWGFYDV LFDGKPFRFQ RPYGTYVMEN VLFKIAFPAE FHAQTAAEAA       300
     LQLHAQLAAA GRTTDDISRI TIRTHAAAIR IIDKQGPLAN PADRDHCIQY MVAVPLLFGR       360
     LTAADYEDAA AADPRIDALR AKTVCVEDPQ FTKDYHDPDK RSIANALTIA FTDGSKLAEV       420
     AVEYPLGHRR RRAEGVPLLV EKFRTNLARR FPAKQQQAIL DVSLDQAKLE AMPVDEYVDL       480
     YVI                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page