(data stored in ACNUC1104 zone)

EMBL: CP000959.PE412

CP000959.PE412       Location/Qualifiers
FT   CDS             complement(488107..488550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3601"
FT                   /product="Domain of unknown function DUF1801"
FT                   /note="PFAM: Domain of unknown function DUF1801; KEGG:
FT                   bur:Bcep18194_B2159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3601"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92753"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3N2"
FT                   /protein_id="ACA92753.1"
FT                   /translation="MSAASDPTPSERIDALIAGIVDWRGKTFAELRQTILAADDSIVEE
FT                   WKWMGSPVWSCDGMIAVANAHKGKVKLTFMHGAKLPDPDQLFNDGLEGNARRAIDFFEG
FT                   DKLDKRALKHLVRAAIEYNRTHLKKNARAGSSAGAKVRSSKAA"
     MSAASDPTPS ERIDALIAGI VDWRGKTFAE LRQTILAADD SIVEEWKWMG SPVWSCDGMI        60
     AVANAHKGKV KLTFMHGAKL PDPDQLFNDG LEGNARRAID FFEGDKLDKR ALKHLVRAAI       120
     EYNRTHLKKN ARAGSSAGAK VRSSKAA                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page