(data stored in ACNUC1104 zone)

EMBL: CP000959.PE417

CP000959.PE417       Location/Qualifiers
FT   CDS             complement(493527..494372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3606"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B2167 ABC
FT                   spermidine/putrescine transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3606"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92758"
FT                   /db_xref="GOA:B1K3N7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3N7"
FT                   /protein_id="ACA92758.1"
FT                   /translation="MPTMKLARPLFAPHMSFVERAWYVALRVLVVLTLLYLILPVLAIV
FT                   PLSFSSSTFLVYPIPGFSLRWYENLIASDEWRMAAKNSFIVAPSATVVATVLGTLAAIG
FT                   LTKADFRGKGLLMAVLLSPMIVPVVVVGVGMYLFFAPLGLANTYTGLIAAHAALGVPFV
FT                   VTTVAATLQGFNQNLVRASLSLGANPVTTFFRVTLPVIAPGVMSGALFAFATSFDEVVV
FT                   TLFLAGADQTTLPRQMFTGIRENISPTIAALATILIIFSTSLLLALEWLRGRNARRAVT
FT                   "
     MPTMKLARPL FAPHMSFVER AWYVALRVLV VLTLLYLILP VLAIVPLSFS SSTFLVYPIP        60
     GFSLRWYENL IASDEWRMAA KNSFIVAPSA TVVATVLGTL AAIGLTKADF RGKGLLMAVL       120
     LSPMIVPVVV VGVGMYLFFA PLGLANTYTG LIAAHAALGV PFVVTTVAAT LQGFNQNLVR       180
     ASLSLGANPV TTFFRVTLPV IAPGVMSGAL FAFATSFDEV VVTLFLAGAD QTTLPRQMFT       240
     GIRENISPTI AALATILIIF STSLLLALEW LRGRNARRAV T                           281
//

If you have problems or comments...

PBIL Back to PBIL home page