(data stored in ACNUC1104 zone)

EMBL: CP000959.PE420

CP000959.PE420       Location/Qualifiers
FT   CDS             complement(496893..498005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3609"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: bur:Bcep18194_B2170 spermidine/putrescine ABC
FT                   transporter ATPase subunit; TIGRFAM: spermidine/putrescine
FT                   ABC transporter ATPase subunit; PFAM: ABC transporter
FT                   related; Transport-associated OB domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3609"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92761"
FT                   /db_xref="GOA:B1K3P0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3P0"
FT                   /protein_id="ACA92761.1"
FT                   /translation="MKSDDVIVSFRGVRKTYDGETLVVKSLDLDIQRGEFLTLLGPSGS
FT                   GKTTCLMMLAGFEFPTGGEIRLDGELLNSVPPHKRNIGMVFQNYALFPHLTVEQNVGYP
FT                   LTVRKLPAAERAERVAHALKMVQMERFAKRYPAQLSGGQQQRIALARALVFEPKLVLMD
FT                   EPLGALDKQLREHMQYELKALHEKLGVTFVYVTHDQGEALTMSDRVAVFDKGIVQQLDT
FT                   VDRLYESPCNEFVANFIGDSNRLRGTIARVDGEFCEFRLDDGTKLVGRHIGEAAEGASA
FT                   VACIRPERMSLAAHGVNGANGANGAAANCVSGEARSLIYFGDHVRMRCALPGQDECFVK
FT                   VPLGTGALDAFSPGAPVSLAFSPEHLRVFA"
     MKSDDVIVSF RGVRKTYDGE TLVVKSLDLD IQRGEFLTLL GPSGSGKTTC LMMLAGFEFP        60
     TGGEIRLDGE LLNSVPPHKR NIGMVFQNYA LFPHLTVEQN VGYPLTVRKL PAAERAERVA       120
     HALKMVQMER FAKRYPAQLS GGQQQRIALA RALVFEPKLV LMDEPLGALD KQLREHMQYE       180
     LKALHEKLGV TFVYVTHDQG EALTMSDRVA VFDKGIVQQL DTVDRLYESP CNEFVANFIG       240
     DSNRLRGTIA RVDGEFCEFR LDDGTKLVGR HIGEAAEGAS AVACIRPERM SLAAHGVNGA       300
     NGANGAAANC VSGEARSLIY FGDHVRMRCA LPGQDECFVK VPLGTGALDA FSPGAPVSLA       360
     FSPEHLRVFA                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page