(data stored in ACNUC1104 zone)

EMBL: CP000959.PE423

CP000959.PE423       Location/Qualifiers
FT   CDS             complement(500705..501799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3612"
FT                   /product="Triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /note="PFAM: alpha/beta hydrolase fold; Protein of unknown
FT                   function DUF676 hydrolase domain protein; PGAP1 family
FT                   protein; KEGG: bam:Bamb_3293 triacylglycerol lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3612"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92764"
FT                   /db_xref="GOA:B1K3P3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3P3"
FT                   /protein_id="ACA92764.1"
FT                   /translation="MARSMRSRVMAGAVACAMSVAPFAGTTALMTLATTHTAMAATAPA
FT                   DNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQENLQQHGATVYVANLSGFQSDDGPNG
FT                   RGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEF
FT                   ADFVQGVLAYDPTGLSSTVIAAFVNVFGILTSSSHNTNQDALAALKTLTTGQAATYNQN
FT                   YPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTFSVLGVTGATDTSTIPLVDP
FT                   ANVLDLSTLALLGTGTVMINRASGQNDGLVSKCSALYGKVLSTSYKWNHIDEINQLLGV
FT                   RGAYAEDPVAVIRTHANRLKLAGV"
     MARSMRSRVM AGAVACAMSV APFAGTTALM TLATTHTAMA ATAPADNYAA TRYPIILVHG        60
     LTGTDKYAGV LEYWYGIQEN LQQHGATVYV ANLSGFQSDD GPNGRGEQLL AYVKTVLAAT       120
     GATKVNLVGH SQGGLTSRYV AAVAPDLVAS VTTIGTPHRG SEFADFVQGV LAYDPTGLSS       180
     TVIAAFVNVF GILTSSSHNT NQDALAALKT LTTGQAATYN QNYPSAGLGA PGSCQTGAPT       240
     ETVGGNTHLL YSWAGTAIQP TFSVLGVTGA TDTSTIPLVD PANVLDLSTL ALLGTGTVMI       300
     NRASGQNDGL VSKCSALYGK VLSTSYKWNH IDEINQLLGV RGAYAEDPVA VIRTHANRLK       360
     LAGV                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page