(data stored in ACNUC1104 zone)

EMBL: CP000959.PE424

CP000959.PE424       Location/Qualifiers
FT   CDS             complement(502019..504151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3613"
FT                   /product="TonB-dependent copper receptor"
FT                   /note="TIGRFAM: TonB-dependent copper receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: bur:Bcep18194_B2174 TonB-dependent copper receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3613"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92765"
FT                   /db_xref="GOA:B1K3P4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010100"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3P4"
FT                   /protein_id="ACA92765.1"
FT                   /translation="MTNFLLRAPRAPRNAGARPLPRVLKLTVPALAVGALAASAAAAET
FT                   TPAAGAPSGDAAMLLPPVEVVASPLSTPLVVVTDPKAPRQPLPASDGADYLKTIPGFTS
FT                   IRSGGTNGDPVLRGMFGSRLNILANGMPTLGACPNRMDAPTSYIAPESYDKVTVVKGPQ
FT                   TVLYGPGASAGTVLFERVTPRFERPGMRFDGSLVGGSFGRNDQNIDLTAGTPDIYGRVT
FT                   ANHAHSQDYKDGNGNTVPSQWDKWNADAALGWTPDDHTRLELTAGTGDGYARYAGRGMD
FT                   GAHFRRETFGLSFDKRHLGDVLDRIEARVYYNEADHVMDNYTLRQPDPTSSMPMRMAAD
FT                   VRRRTVGARAAATFRFGDDFKLVTGVDAQSNRLDSRASMGQQNYRDQPWDAQATMWSAG
FT                   VFSELTWYASDVSRVIGGARVDYASARDKRAMKSGMMMSKPNPTFDDDRTKVLPSGFVR
FT                   YERDLASLPVTWYAGIGHAERYPDYWELFSATRGPAGSINAFSAVQPEKTTQLDIGAQY
FT                   KSDRFDAWVSAYAGYVQDFILFNYAAGMMGPITQATNVNAQIMGGEAGVSWRPVAPLRV
FT                   ETSLAYAWGRNVASGDPLPQMPPLEARIGLEYTRGAWSAGGLWRIVAPQHRYALNEGNV
FT                   VGKDFGPSAGFGVLSLHTQYNVSKTVQISVGVDNVLNKAYTEHLNLAGNAGFGYPANAP
FT                   VMEPGRTAWVRVSAKL"
     MTNFLLRAPR APRNAGARPL PRVLKLTVPA LAVGALAASA AAAETTPAAG APSGDAAMLL        60
     PPVEVVASPL STPLVVVTDP KAPRQPLPAS DGADYLKTIP GFTSIRSGGT NGDPVLRGMF       120
     GSRLNILANG MPTLGACPNR MDAPTSYIAP ESYDKVTVVK GPQTVLYGPG ASAGTVLFER       180
     VTPRFERPGM RFDGSLVGGS FGRNDQNIDL TAGTPDIYGR VTANHAHSQD YKDGNGNTVP       240
     SQWDKWNADA ALGWTPDDHT RLELTAGTGD GYARYAGRGM DGAHFRRETF GLSFDKRHLG       300
     DVLDRIEARV YYNEADHVMD NYTLRQPDPT SSMPMRMAAD VRRRTVGARA AATFRFGDDF       360
     KLVTGVDAQS NRLDSRASMG QQNYRDQPWD AQATMWSAGV FSELTWYASD VSRVIGGARV       420
     DYASARDKRA MKSGMMMSKP NPTFDDDRTK VLPSGFVRYE RDLASLPVTW YAGIGHAERY       480
     PDYWELFSAT RGPAGSINAF SAVQPEKTTQ LDIGAQYKSD RFDAWVSAYA GYVQDFILFN       540
     YAAGMMGPIT QATNVNAQIM GGEAGVSWRP VAPLRVETSL AYAWGRNVAS GDPLPQMPPL       600
     EARIGLEYTR GAWSAGGLWR IVAPQHRYAL NEGNVVGKDF GPSAGFGVLS LHTQYNVSKT       660
     VQISVGVDNV LNKAYTEHLN LAGNAGFGYP ANAPVMEPGR TAWVRVSAKL                  710
//

If you have problems or comments...

PBIL Back to PBIL home page