(data stored in ACNUC1104 zone)

EMBL: CP000959.PE425

CP000959.PE425       Location/Qualifiers
FT   CDS             complement(504236..504604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3614"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3614"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92766"
FT                   /db_xref="InterPro:IPR021333"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3P5"
FT                   /protein_id="ACA92766.1"
FT                   /translation="MLHRHRHLTAWLGLLAIWIAIAAPLVSQWRIAQAAVPEAIVCSTE
FT                   HGAHRSSDVGGMHDHALHLDACGYCGFFAHSPAIGAPAATSVAFIPVVFVSAVASPAVA
FT                   ARGDRYPRAYPRAPPERA"
     MLHRHRHLTA WLGLLAIWIA IAAPLVSQWR IAQAAVPEAI VCSTEHGAHR SSDVGGMHDH        60
     ALHLDACGYC GFFAHSPAIG APAATSVAFI PVVFVSAVAS PAVAARGDRY PRAYPRAPPE       120
     RA                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page