(data stored in ACNUC1104 zone)

EMBL: CP000959.PE43

CP000959.PE43        Location/Qualifiers
FT   CDS             51280..52764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3228"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: heavy metal sensor kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein; histidine kinase A domain
FT                   protein; KEGG: bam:Bamb_3707 heavy metal sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3228"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92384"
FT                   /db_xref="GOA:B1K8N7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8N7"
FT                   /protein_id="ACA92384.1"
FT                   /translation="MKRSIILRLSAMFGIVSLLVFTLVGCGLFVMMERQLFAELRATID
FT                   MRAKVAQMIVSHATTASRGRLMQEKLADLEPPDGSTHYQVISDNPAFRFGSPVDGVPLD
FT                   PPFGAFQRYQLNDSSYAVMTKTITLAGAGERPTLQLVVATSCERTQRMLRRFGWTLAAL
FT                   IATATVITLLLSRAVARFGLAPLDRLSQDAASVSATNRRQRLHTDALPTELRDLATSFN
FT                   GALERIQQTYARLEAFNADVAHELRTPISILIGQTQVALTSRDRSVDRMRQTLQSNLEE
FT                   FERLRVIINDMLFLSRSDRGERASDLKDVSLADEVRRMLDFLEIPLDEAQLRAELHGDA
FT                   RAAVDPSLFRRAMTNLLINAIQHSAPGATLNVTITRRDTLVEMAVSNPGEPIDPVQRSH
FT                   VFERFYRLEEARANSKENHGLGLSIVKAVAEMHGGGVFVACSGGVNTFGFSVSTQPWPG
FT                   GPLRPADAAGPAESTDSAASADPHDARPTHAPRALH"
     MKRSIILRLS AMFGIVSLLV FTLVGCGLFV MMERQLFAEL RATIDMRAKV AQMIVSHATT        60
     ASRGRLMQEK LADLEPPDGS THYQVISDNP AFRFGSPVDG VPLDPPFGAF QRYQLNDSSY       120
     AVMTKTITLA GAGERPTLQL VVATSCERTQ RMLRRFGWTL AALIATATVI TLLLSRAVAR       180
     FGLAPLDRLS QDAASVSATN RRQRLHTDAL PTELRDLATS FNGALERIQQ TYARLEAFNA       240
     DVAHELRTPI SILIGQTQVA LTSRDRSVDR MRQTLQSNLE EFERLRVIIN DMLFLSRSDR       300
     GERASDLKDV SLADEVRRML DFLEIPLDEA QLRAELHGDA RAAVDPSLFR RAMTNLLINA       360
     IQHSAPGATL NVTITRRDTL VEMAVSNPGE PIDPVQRSHV FERFYRLEEA RANSKENHGL       420
     GLSIVKAVAE MHGGGVFVAC SGGVNTFGFS VSTQPWPGGP LRPADAAGPA ESTDSAASAD       480
     PHDARPTHAP RALH                                                         494
//

If you have problems or comments...

PBIL Back to PBIL home page