(data stored in ACNUC1104 zone)

EMBL: CP000959.PE430

CP000959.PE430       Location/Qualifiers
FT   CDS             complement(507802..508146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3619"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_4675 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3619"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92771"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3Q0"
FT                   /protein_id="ACA92771.1"
FT                   /translation="MKSLIATFAAAAVLAVPAVSFAQQNAPVTRAQVKAELVQLQQAGY
FT                   KLGSDRTNYPEGIQAAEARVNPQQNVAAADTTGYGAQPAAGQESGAPAAAKTGWQVKRV
FT                   SDGAPVYKGR"
     MKSLIATFAA AAVLAVPAVS FAQQNAPVTR AQVKAELVQL QQAGYKLGSD RTNYPEGIQA        60
     AEARVNPQQN VAAADTTGYG AQPAAGQESG APAAAKTGWQ VKRVSDGAPV YKGR             114
//

If you have problems or comments...

PBIL Back to PBIL home page