(data stored in ACNUC1104 zone)

EMBL: CP000959.PE432

CP000959.PE432       Location/Qualifiers
FT   CDS             complement(509857..510498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3621"
FT                   /product="protein of unknown function DUF938"
FT                   /note="PFAM: protein of unknown function DUF938;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   bur:Bcep18194_B2182 protein of unknown function DUF938"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3621"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92773"
FT                   /db_xref="InterPro:IPR010342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3Q2"
FT                   /protein_id="ACA92773.1"
FT                   /translation="MTGAAASPDPSERLSAPAAERNRGPILDVLRRVLPASGSVLEIAS
FT                   GTGQHVVHFAQALPGLHWQPSDPDAQARRSIAAWVAHAGLANVAGPLAFDVRDAPWPVA
FT                   ALDAIVCINMIHISPWACTDALFAGASRVLRPGGVLFLYGPYRREGRHTAPSNEAFDRQ
FT                   LRSRDPSWGVRDLETVVALGLDLGLDCSEVVEMPANNLSVVFRRLPHAEQ"
     MTGAAASPDP SERLSAPAAE RNRGPILDVL RRVLPASGSV LEIASGTGQH VVHFAQALPG        60
     LHWQPSDPDA QARRSIAAWV AHAGLANVAG PLAFDVRDAP WPVAALDAIV CINMIHISPW       120
     ACTDALFAGA SRVLRPGGVL FLYGPYRREG RHTAPSNEAF DRQLRSRDPS WGVRDLETVV       180
     ALGLDLGLDC SEVVEMPANN LSVVFRRLPH AEQ                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page