(data stored in ACNUC1104 zone)

EMBL: CP000959.PE434

CP000959.PE434       Location/Qualifiers
FT   CDS             512628..513587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3623"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG:
FT                   bur:Bcep18194_B2188 flavin-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3623"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92775"
FT                   /db_xref="GOA:B1K3Q4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR020020"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3Q4"
FT                   /protein_id="ACA92775.1"
FT                   /translation="MPPTVPARPDVAQRVFADGRLSIGLTLPLLRSGHIVADFDEQLEL
FT                   AALADSLGFRALWIRDVPLNSADYPDPVGHLDPWVLLGALASRTRRIALASGAIVLPLR
FT                   HPLHIAKGALSVATLSGGRFILGLGSGDRPPEYAAFGVDAETRRDRYRAHWDVVAAALG
FT                   APSRVLPDQAPPDAPEFTLLPRDGDAVPMLAVGSGGQSVDWIARHSIGWMTYHRDPDTQ
FT                   RARYSMWRAAVDRLASPQFRAFGVSMRLDLAAHPDTPATALPLGYATGRHALADILRDM
FT                   RTAGTHHVTLNPGSDRPVRDVIEEIAAHVLPAFHDDPA"
     MPPTVPARPD VAQRVFADGR LSIGLTLPLL RSGHIVADFD EQLELAALAD SLGFRALWIR        60
     DVPLNSADYP DPVGHLDPWV LLGALASRTR RIALASGAIV LPLRHPLHIA KGALSVATLS       120
     GGRFILGLGS GDRPPEYAAF GVDAETRRDR YRAHWDVVAA ALGAPSRVLP DQAPPDAPEF       180
     TLLPRDGDAV PMLAVGSGGQ SVDWIARHSI GWMTYHRDPD TQRARYSMWR AAVDRLASPQ       240
     FRAFGVSMRL DLAAHPDTPA TALPLGYATG RHALADILRD MRTAGTHHVT LNPGSDRPVR       300
     DVIEEIAAHV LPAFHDDPA                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page