(data stored in ACNUC1104 zone)

EMBL: CP000959.PE437

CP000959.PE437       Location/Qualifiers
FT   CDS             517282..518406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3626"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   bur:Bcep18194_B2191 secretion protein, HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3626"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92778"
FT                   /db_xref="GOA:B1K3Q7"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3Q7"
FT                   /protein_id="ACA92778.1"
FT                   /translation="MSTPQDPPQKADRQENKTTPRNGNGGTRRRILLVVAVLAAVGGAV
FT                   WLGRWWTVGRFIESTNDAYLQADSMTAAPKVAGYVTDVYVRDNQPVKAGDPLVRLDVRQ
FT                   YQVALAQAQATVDARRADIARAEADISQQRANLEQADAQAKVSRINAQHASDEYTRYAP
FT                   LAATGAETHERVADLKSTRDQAAATLAANNASIAAARTQIASFTAQLQQARAQLEAAQA
FT                   SAAQAQLDLDNTIVRSTLAGRVGDRTVRVGQYVQPGTRLLTVVPVDSIYLVANFKETQI
FT                   GNMRIGQPVELHVDALPDGPLSGVVDSFAPGTGAQFALLPPENATGNFTKIVQRVPVRI
FT                   RLAANARAQRMLLPGLSVTVDVDTRSARDEQHHG"
     MSTPQDPPQK ADRQENKTTP RNGNGGTRRR ILLVVAVLAA VGGAVWLGRW WTVGRFIEST        60
     NDAYLQADSM TAAPKVAGYV TDVYVRDNQP VKAGDPLVRL DVRQYQVALA QAQATVDARR       120
     ADIARAEADI SQQRANLEQA DAQAKVSRIN AQHASDEYTR YAPLAATGAE THERVADLKS       180
     TRDQAAATLA ANNASIAAAR TQIASFTAQL QQARAQLEAA QASAAQAQLD LDNTIVRSTL       240
     AGRVGDRTVR VGQYVQPGTR LLTVVPVDSI YLVANFKETQ IGNMRIGQPV ELHVDALPDG       300
     PLSGVVDSFA PGTGAQFALL PPENATGNFT KIVQRVPVRI RLAANARAQR MLLPGLSVTV       360
     DVDTRSARDE QHHG                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page