(data stored in ACNUC1104 zone)

EMBL: CP000959.PE439

CP000959.PE439       Location/Qualifiers
FT   CDS             519999..521486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3628"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bur:Bcep18194_B2193 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3628"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92780"
FT                   /db_xref="GOA:B1K3Q9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3Q9"
FT                   /protein_id="ACA92780.1"
FT                   /translation="MKPFSLPRRPALTLCAAACLLAGCTVGPDYHGAPAAPDASTFVRA
FT                   PATGVDTASPAPSAWWHALNDRQLDALIVAALVYNPDLHAAQARLRAARAQLSQQRAAQ
FT                   MPKSSATVAAIRMREPDVSALGSLLPSNGSEQSGGTSPSLGGSGPLQLYSAGFDATWEI
FT                   DLFGGTRRAVEAASAQAEAVDADLADTQVSIAAEVANAYVDLRDQQQRLALSKRTAQLQ
FT                   QQMLELTQQRRARGVAADADIERLTTQVENTRASLIPLDAQVTESLDRLAILTGRAPGA
FT                   LDAALSTPDAALPTLPGSVAIGDPATLLKQRPDIRAAERRLASSNAQIGEHVADYFPKV
FT                   TLLGDLGFSATDPGHLFRKQNFTWVGAPYLQWNILDFGRTRGAVRAAEASRDEAEANYQ
FT                   KAVLGALQDANTALQRYGHQREHVVALTKVQTSAVHSRALMDQRYRAGVASMIDLLDTQ
FT                   REAFAAQQNVIAGQAELIKNYVSVQKSLGLGWQTSAG"
     MKPFSLPRRP ALTLCAAACL LAGCTVGPDY HGAPAAPDAS TFVRAPATGV DTASPAPSAW        60
     WHALNDRQLD ALIVAALVYN PDLHAAQARL RAARAQLSQQ RAAQMPKSSA TVAAIRMREP       120
     DVSALGSLLP SNGSEQSGGT SPSLGGSGPL QLYSAGFDAT WEIDLFGGTR RAVEAASAQA       180
     EAVDADLADT QVSIAAEVAN AYVDLRDQQQ RLALSKRTAQ LQQQMLELTQ QRRARGVAAD       240
     ADIERLTTQV ENTRASLIPL DAQVTESLDR LAILTGRAPG ALDAALSTPD AALPTLPGSV       300
     AIGDPATLLK QRPDIRAAER RLASSNAQIG EHVADYFPKV TLLGDLGFSA TDPGHLFRKQ       360
     NFTWVGAPYL QWNILDFGRT RGAVRAAEAS RDEAEANYQK AVLGALQDAN TALQRYGHQR       420
     EHVVALTKVQ TSAVHSRALM DQRYRAGVAS MIDLLDTQRE AFAAQQNVIA GQAELIKNYV       480
     SVQKSLGLGW QTSAG                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page