(data stored in ACNUC1104 zone)

EMBL: CP000959.PE442

CP000959.PE442       Location/Qualifiers
FT   CDS             524353..525513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3631"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bmu:Bmul_4356 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3631"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92783"
FT                   /db_xref="GOA:B1K3R2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3R2"
FT                   /protein_id="ACA92783.1"
FT                   /translation="MKNQKRCCHGAVCALVAAMLAGCGPSEQQAAAPATPVAAMTVAAT
FT                   RVDVTEDLPGRVAAVRVAEIRPQVSGIVQRRLFEQGTEVRAGQPLFQINPAPFKAEMDT
FT                   AAASLQRAQAALERAKVQTARFKPLVEADAISRQVYDDAVSQRDQAAADVAQARATLAR
FT                   RQLDLKFATVEAPIAGRIDQALVTEGALVSSSDSQPMARIQQIDQVYVDVRQPAASLEA
FT                   LRDALASQPQASDGNGLPVDVLRDDDTRYDVRGRMLFSGVNVDPGTGDVLLRVLVDNPK
FT                   RQLLPGMYVRARIPRAHYANAVMVPQQAIVRAGGKPQVWVLDAKGTARLKAVEVGELTN
FT                   RSYRIKSGLQAGQKIVVEGMERLTDGAPAAATDWKSPDAVATASAH"
     MKNQKRCCHG AVCALVAAML AGCGPSEQQA AAPATPVAAM TVAATRVDVT EDLPGRVAAV        60
     RVAEIRPQVS GIVQRRLFEQ GTEVRAGQPL FQINPAPFKA EMDTAAASLQ RAQAALERAK       120
     VQTARFKPLV EADAISRQVY DDAVSQRDQA AADVAQARAT LARRQLDLKF ATVEAPIAGR       180
     IDQALVTEGA LVSSSDSQPM ARIQQIDQVY VDVRQPAASL EALRDALASQ PQASDGNGLP       240
     VDVLRDDDTR YDVRGRMLFS GVNVDPGTGD VLLRVLVDNP KRQLLPGMYV RARIPRAHYA       300
     NAVMVPQQAI VRAGGKPQVW VLDAKGTARL KAVEVGELTN RSYRIKSGLQ AGQKIVVEGM       360
     ERLTDGAPAA ATDWKSPDAV ATASAH                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page