(data stored in ACNUC1104 zone)

EMBL: CP000959.PE444

CP000959.PE444       Location/Qualifiers
FT   CDS             528682..530112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3633"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bur:Bcep18194_C6823 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3633"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92785"
FT                   /db_xref="GOA:B1K3R4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3R4"
FT                   /protein_id="ACA92785.1"
FT                   /translation="MRLLILPLVLALSACSLAPTLVKPSMPVPTAYTAAAAANPDANAA
FT                   DLGWRTMFGDRRLQRLIELALEHNRDLRVAALNVEAAEAQYGIQRAARLPSIGAGASFT
FT                   RQRTSDDTQSNPPLFGATQNQYGVNVGISAFEIDLFGRVKSMSDAAFARYLATDHGRRA
FT                   VQISLVGGVADAYFAERLAHEQRQLSERTLADWQQSLDLARRLKEAHQASGVDIAQAEG
FT                   QVASATADLEARTRAVEQARNALRLLIGTELPKDLPEPLPLQQQPVMTQLPAGLPSELL
FT                   FRRPDIQQAEQNLVAANADIGAARAAFFPRLSLTSSIGFLSPAMGSLFDGGQRAWSFAP
FT                   QVTVPIFQGGRLRAELRLAEVRKSSAVAEYERAIQAAFREVADGIAGRETFGRQIEAQT
FT                   RVVGSAERRADLSNLRYRAGVEGRLELLDSQRQLYAARQALLDLRRSELGNAVALYKAL
FT                   GGGLTDQDVAPSKRVMQN"
     MRLLILPLVL ALSACSLAPT LVKPSMPVPT AYTAAAAANP DANAADLGWR TMFGDRRLQR        60
     LIELALEHNR DLRVAALNVE AAEAQYGIQR AARLPSIGAG ASFTRQRTSD DTQSNPPLFG       120
     ATQNQYGVNV GISAFEIDLF GRVKSMSDAA FARYLATDHG RRAVQISLVG GVADAYFAER       180
     LAHEQRQLSE RTLADWQQSL DLARRLKEAH QASGVDIAQA EGQVASATAD LEARTRAVEQ       240
     ARNALRLLIG TELPKDLPEP LPLQQQPVMT QLPAGLPSEL LFRRPDIQQA EQNLVAANAD       300
     IGAARAAFFP RLSLTSSIGF LSPAMGSLFD GGQRAWSFAP QVTVPIFQGG RLRAELRLAE       360
     VRKSSAVAEY ERAIQAAFRE VADGIAGRET FGRQIEAQTR VVGSAERRAD LSNLRYRAGV       420
     EGRLELLDSQ RQLYAARQAL LDLRRSELGN AVALYKALGG GLTDQDVAPS KRVMQN           476
//

If you have problems or comments...

PBIL Back to PBIL home page