(data stored in ACNUC1104 zone)

EMBL: CP000959.PE452

CP000959.PE452       Location/Qualifiers
FT   CDS             complement(540580..542631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3641"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   1.1 domain protein; sigma-70 region 3 domain protein;
FT                   sigma-70 region 2 domain protein; sigma-70 region 4 domain
FT                   protein; sigma-70 non-essential domain protein; sigma-70
FT                   region 1.2; KEGG: bam:Bamb_3257 RNA polymerase, sigma 70
FT                   subunit, RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3641"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92793"
FT                   /db_xref="GOA:B1K3S2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3S2"
FT                   /protein_id="ACA92793.1"
FT                   /translation="MTKKLNEVSVEDDANQSDEQPAAAAAPGKSKVRDRRAKEKALLKE
FT                   AFATSTPGTAEELEERRVKLRALIKLGKERGFLTYAEINDHLPDNFTETEALEGIIGTF
FT                   NDMGVAVYEQAPDAETLLLNDNAPAASSDDEVEEEAEVALSTVDSEFGRTTDPVRMYMR
FT                   EMGTVELLTREGEIEIAKRIEDGLRHMVMAISACPTTIADILAMAERVANEEIRVDELV
FT                   DGLLDPNASDSADTDGFSAKEAEAIENEDEEAEEEEEEEEEEEDDGAAQASANAAQLEA
FT                   LKRASLEKFSQISEWFDKMRRAFEKEGYKSKAYLKAQETIQSELMTIRFTARTVERLCD
FT                   TLRAQVDEVRQVERQILHIVVDKCGMPRSEFIARFPGSETDLDWAEKITAEGHPYSAVL
FT                   SRNVPAIREQQQRLLDLQARVVLPLKDLKETNRQMAAGELKARQAKREMTEANLRLVIS
FT                   IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQAR
FT                   TIRIPVHMIETINKMNRISRQILQETGLEPDPATLAEKMEMPEDKIRKIMKIAKEPISM
FT                   ETPIGDDDDSHLGDFIEDTNTVAPADAALHASMRDVVKDVLDSLTPREAKVLRMRFGIE
FT                   MSTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSDKLKSFLEGN"
     MTKKLNEVSV EDDANQSDEQ PAAAAAPGKS KVRDRRAKEK ALLKEAFATS TPGTAEELEE        60
     RRVKLRALIK LGKERGFLTY AEINDHLPDN FTETEALEGI IGTFNDMGVA VYEQAPDAET       120
     LLLNDNAPAA SSDDEVEEEA EVALSTVDSE FGRTTDPVRM YMREMGTVEL LTREGEIEIA       180
     KRIEDGLRHM VMAISACPTT IADILAMAER VANEEIRVDE LVDGLLDPNA SDSADTDGFS       240
     AKEAEAIENE DEEAEEEEEE EEEEEDDGAA QASANAAQLE ALKRASLEKF SQISEWFDKM       300
     RRAFEKEGYK SKAYLKAQET IQSELMTIRF TARTVERLCD TLRAQVDEVR QVERQILHIV       360
     VDKCGMPRSE FIARFPGSET DLDWAEKITA EGHPYSAVLS RNVPAIREQQ QRLLDLQARV       420
     VLPLKDLKET NRQMAAGELK ARQAKREMTE ANLRLVISIA KKYTNRGLQF LDLIQEGNIG       480
     LMKAVDKFEY RRGYKFSTYA TWWIRQAITR SIADQARTIR IPVHMIETIN KMNRISRQIL       540
     QETGLEPDPA TLAEKMEMPE DKIRKIMKIA KEPISMETPI GDDDDSHLGD FIEDTNTVAP       600
     ADAALHASMR DVVKDVLDSL TPREAKVLRM RFGIEMSTDH TLEEVGKQFD VTRERIRQIE       660
     AKALRKLRHP SRSDKLKSFL EGN                                               683
//

If you have problems or comments...

PBIL Back to PBIL home page