(data stored in ACNUC1104 zone)

EMBL: CP000959.PE453

CP000959.PE453       Location/Qualifiers
FT   CDS             complement(543086..544963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3642"
FT                   /product="DNA primase"
FT                   /note="KEGG: bur:Bcep18194_B2205 DNA primase; TIGRFAM: DNA
FT                   primase; PFAM: zinc finger CHC2-family protein; TOPRIM
FT                   domain protein; DNA primase DnaG DnaB-binding; DNA primase
FT                   catalytic core domain; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3642"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92794"
FT                   /db_xref="GOA:B1K3S3"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3S3"
FT                   /protein_id="ACA92794.1"
FT                   /translation="MIPHSFLQDLLNRVDIVDVVGRYVQLKKGGANFMGLCPFHNEKSP
FT                   SFTVSPTKQFYHCFGCGAHGTAIGFLMEHAGLTFPEAVQELAQSVGLTVPHEPSMRGGG
FT                   GGGGGGGDYPAPVSKSVATALSDAMTAACDYYRKQLRGATVAIQYLKNRGLTGEIAARF
FT                   GLGYAPDGWQNLEAAFPDYRDESLVEAGLVIVSEKTDAQGVARRYDRFRERIMFPIRNV
FT                   KGQVIGFGGRVLGSGEPKYLNSPETPLFNKGSELYGLFEARLAIRERKYVLVVEGYMDV
FT                   VALAQLGFPNAVATLGTACTPIHVQKLLRQTDTVIFSFDGDSAGRRAARRALEACLPHA
FT                   GDNRTIRFLFLPTEHDPDSYVREFGAEAFSEQVERAMPLSQFLLNEAIAGKALDQPEGR
FT                   AKALFDAKPLLQALPANALRAQIMHMFADRLDIPFEEVAALSDVDTRIATPPRQAPARS
FT                   ERRRVTDSEKRALRTLVMHPRIASQLDDEQIATLRALPRIGELFAEVVDHARALGDGAE
FT                   FRLLSDVLRTSSNGATYEEIFREILDYDENVRDLLLQNPEDETVPERQREQERIAGEEL
FT                   QAAVLKMRYDACCDRLDRLARQSTFTPEELAELTELNQQRTDMKRRLGL"
     MIPHSFLQDL LNRVDIVDVV GRYVQLKKGG ANFMGLCPFH NEKSPSFTVS PTKQFYHCFG        60
     CGAHGTAIGF LMEHAGLTFP EAVQELAQSV GLTVPHEPSM RGGGGGGGGG GDYPAPVSKS       120
     VATALSDAMT AACDYYRKQL RGATVAIQYL KNRGLTGEIA ARFGLGYAPD GWQNLEAAFP       180
     DYRDESLVEA GLVIVSEKTD AQGVARRYDR FRERIMFPIR NVKGQVIGFG GRVLGSGEPK       240
     YLNSPETPLF NKGSELYGLF EARLAIRERK YVLVVEGYMD VVALAQLGFP NAVATLGTAC       300
     TPIHVQKLLR QTDTVIFSFD GDSAGRRAAR RALEACLPHA GDNRTIRFLF LPTEHDPDSY       360
     VREFGAEAFS EQVERAMPLS QFLLNEAIAG KALDQPEGRA KALFDAKPLL QALPANALRA       420
     QIMHMFADRL DIPFEEVAAL SDVDTRIATP PRQAPARSER RRVTDSEKRA LRTLVMHPRI       480
     ASQLDDEQIA TLRALPRIGE LFAEVVDHAR ALGDGAEFRL LSDVLRTSSN GATYEEIFRE       540
     ILDYDENVRD LLLQNPEDET VPERQREQER IAGEELQAAV LKMRYDACCD RLDRLARQST       600
     FTPEELAELT ELNQQRTDMK RRLGL                                             625
//

If you have problems or comments...

PBIL Back to PBIL home page